Result : Q9WX37
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Putative RNA-binding protein RbpE |
| NCBI Accession ID | BA000019.2 |
| Organism | Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576) |
| Left | 3374343 |
| Right | 3374642 |
| Strand | - |
| Nucleotide Sequence | ATGTCAATATACGTAGGGAATCTGTCCTACAGCGTCACACAAGACGACCTTACTAAAGTATTTTCCGAGTACGGTTCAGTCACACGCGTTCAGTTACCCACAGATAGAGAAACCGGACGTGTTCGCGGTTTTGGTTTCGTAGAAATGGAATCATCAGCCGCAGAAGATGCAGCCATTCAAGCTCTTGATGGCGCAGAATGGATGGGGCGTGTACTTAAAGTTAATAAAGCTCGTCCACGGGAAGAGAAAGGCGCTCGTTCCGGTGGGGGTAGTTGGTCAAGAAATAATGGTGGCTACTAA |
| Sequence | MSIYVGNLSYSVTQDDLTKVFSEYGSVTRVQLPTDRETGRVRGFGFVEMESSAAEDAAIQALDGAEWMGRVLKVNKARPREEKGARSGGGSWSRNNGGY |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl17169. Profile Description: RNA recognition motif (RRM) superfamily. Crp79, also called meiotic expression up-regulated protein 5 (Mug5), or polyadenylate-binding protein crp79, or PABP, or poly(A)-binding protein, is an auxiliary mRNA export factor that binds the poly(A) tail of mRNA and is involved in the export of mRNA from the nucleus to the cytoplasm. Mug28 is a meiosis-specific protein that regulates spore wall formation. Members in this family contain three RNA recognition motifs (RRMs), also termed RBDs (RNA binding domains) or RNPs (ribonucleoprotein domains). The model corresponds to the three RRM motif. |
| Pubmed ID | 11759840 |
| Domain | CDD:418427 |
| Functional Category | RNA-binding |
| Uniprot ID | Q9WX37 |
| ORF Length (Amino Acid) | 99 |
++ More..
| Conservation Analysis |
No. of Species: 134
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1319585 | 1319884 | - | NZ_CP047242.1 | Trichormus variabilis 0441 |
| 2 | 5201582 | 5201893 | + | NZ_CP047242.1 | Trichormus variabilis 0441 |
| 3 | 1464512 | 1464823 | + | NZ_CP047242.1 | Trichormus variabilis 0441 |
| 4 | 740553 | 740861 | + | NZ_CP047242.1 | Trichormus variabilis 0441 |
| 5 | 3389630 | 3389914 | + | NZ_CP047242.1 | Trichormus variabilis 0441 |
| 6 | 2081263 | 2081550 | - | NC_019751.1 | Calothrix sp. PCC 6303 |
| 7 | 62512 | 62808 | + | NC_019751.1 | Calothrix sp. PCC 6303 |
| 8 | 5428963 | 5429280 | + | NC_019751.1 | Calothrix sp. PCC 6303 |
| 9 | 4492472 | 4492783 | + | NC_019695.1 | Chroococcidiopsis thermalis PCC 7203 |
| 10 | 6085612 | 6085917 | - | NC_019695.1 | Chroococcidiopsis thermalis PCC 7203 |
| 11 | 2792385 | 2792681 | - | NC_019695.1 | Chroococcidiopsis thermalis PCC 7203 |
| 12 | 52530 | 52829 | + | NZ_AP014638.1 | Leptolyngbya boryana IAM M-101 |
| 13 | 51956 | 52261 | - | NZ_AP014638.1 | Leptolyngbya boryana IAM M-101 |
| 14 | 2461089 | 2461391 | - | NZ_AP014638.1 | Leptolyngbya boryana IAM M-101 |
| 15 | 1576477 | 1576725 | - | NZ_AP014638.1 | Leptolyngbya boryana IAM M-101 |
| 16 | 2170096 | 2170392 | - | NZ_AP014638.1 | Leptolyngbya boryana IAM M-101 |
| 17 | 1842938 | 1843255 | + | NC_011729.1 | Gloeothece citriformis PCC 7424 |
| 18 | 4829678 | 4829971 | - | NC_011729.1 | Gloeothece citriformis PCC 7424 |
| 19 | 1193300 | 1193590 | - | NC_011729.1 | Gloeothece citriformis PCC 7424 |
| 20 | 3169315 | 3169608 | - | NC_011729.1 | Gloeothece citriformis PCC 7424 |
| 21 | 2950519 | 2950833 | + | NC_010628.1 | Nostoc punctiforme PCC 73102 |
| 22 | 935778 | 936080 | + | NC_010628.1 | Nostoc punctiforme PCC 73102 |
| 23 | 1134981 | 1135301 | + | NC_010628.1 | Nostoc punctiforme PCC 73102 |
| 24 | 4768960 | 4769265 | - | NC_014248.1 | 'Nostoc azollae' 0708 |
| 25 | 4104327 | 4104635 | - | NC_014248.1 | 'Nostoc azollae' 0708 |
| 26 | 1165936 | 1166235 | + | NC_014248.1 | 'Nostoc azollae' 0708 |
| 27 | 3541408 | 3541719 | + | NZ_CP054698.1 | Nostoc edaphicum CCNP1411 |
| 28 | 4581774 | 4582079 | - | NZ_CP054698.1 | Nostoc edaphicum CCNP1411 |
| 29 | 474930 | 475250 | + | NZ_CP054698.1 | Nostoc edaphicum CCNP1411 |
| 30 | 2532778 | 2533086 | + | NC_019753.1 | Crinalium epipsammum PCC 9333 |
| 31 | 1165823 | 1166134 | + | NC_019753.1 | Crinalium epipsammum PCC 9333 |
| 32 | 2121475 | 2121783 | + | NC_019753.1 | Crinalium epipsammum PCC 9333 |
| 33 | 6759493 | 6759780 | - | NC_019729.1 | Oscillatoria nigro-viridis PCC 7112 |
| 34 | 6788617 | 6788925 | - | NC_019729.1 | Oscillatoria nigro-viridis PCC 7112 |
| 35 | 3080033 | 3080332 | - | NC_019689.1 | Pleurocapsa sp. PCC 7327 |
| 36 | 4984755 | 4985051 | - | NC_019689.1 | Pleurocapsa sp. PCC 7327 |
| 37 | 3022520 | 3022831 | - | NC_019689.1 | Pleurocapsa sp. PCC 7327 |
| 38 | 4045779 | 4046072 | - | NC_019689.1 | Pleurocapsa sp. PCC 7327 |
| 39 | 3879202 | 3879501 | + | NC_019689.1 | Pleurocapsa sp. PCC 7327 |
| 40 | 136339 | 136620 | - | NC_019689.1 | Pleurocapsa sp. PCC 7327 |
| 41 | 8073349 | 8073648 | - | NZ_CP024785.1 | Nostoc flagelliforme CCNUN1 |
| 42 | 1916010 | 1916309 | + | NZ_CP024785.1 | Nostoc flagelliforme CCNUN1 |
| 43 | 7149470 | 7149799 | + | NZ_CP024785.1 | Nostoc flagelliforme CCNUN1 |
| 44 | 1737734 | 1738021 | - | NC_019780.1 | Dactylococcopsis salina PCC 8305 |
| 45 | 158665 | 158964 | - | NC_019780.1 | Dactylococcopsis salina PCC 8305 |
| 46 | 1561734 | 1562030 | - | NZ_CP060822.1 | Cylindrospermopsis curvispora GIHE-G1 |
| 47 | 2898959 | 2899270 | + | NZ_CP060822.1 | Cylindrospermopsis curvispora GIHE-G1 |
| 48 | 930943 | 931221 | - | NZ_CP060822.1 | Cylindrospermopsis curvispora GIHE-G1 |
| 49 | 1808577 | 1808864 | + | NZ_CP018092.1 | Synechococcus lividus PCC 6715 |
| 50 | 1414466 | 1414711 | + | NZ_CP018092.1 | Synechococcus lividus PCC 6715 |
| 51 | 6114777 | 6115085 | - | NC_019771.1 | Anabaena cylindrica PCC 7122 |
| 52 | 1790798 | 1791088 | - | NC_019748.1 | Stanieria cyanosphaera PCC 7437 |
| 53 | 41789 | 42097 | - | NC_019748.1 | Stanieria cyanosphaera PCC 7437 |
| 54 | 1996936 | 1997226 | - | NC_019748.1 | Stanieria cyanosphaera PCC 7437 |
| 55 | 3628951 | 3629235 | - | NC_019748.1 | Stanieria cyanosphaera PCC 7437 |
| 56 | 2214129 | 2214413 | - | NZ_AP018202.1 | Thermostichus vulcanus NIES-2134 |
| 57 | 215663 | 215935 | - | NZ_AP018202.1 | Thermostichus vulcanus NIES-2134 |
| 58 | 2345110 | 2345394 | - | NC_004113.1 | Thermosynechococcus vestitus BP-1 |
| 59 | 1505782 | 1506054 | + | NC_004113.1 | Thermosynechococcus vestitus BP-1 |
| 60 | 2601475 | 2601771 | - | NZ_CP021983.2 | Halomicronema hongdechloris C2206 |
| 61 | 4984934 | 4985245 | - | NZ_CP021983.2 | Halomicronema hongdechloris C2206 |
| 62 | 4535236 | 4535481 | + | NZ_CP021983.2 | Halomicronema hongdechloris C2206 |
| 63 | 6163857 | 6164156 | + | NZ_CP031941.1 | Nostoc sphaeroides |
| 64 | 4370143 | 4370451 | + | NC_014501.1 | Gloeothece verrucosa PCC 7822 |
| 65 | 5694020 | 5694349 | + | NC_014501.1 | Gloeothece verrucosa PCC 7822 |
| 66 | 5102540 | 5102836 | + | NC_014501.1 | Gloeothece verrucosa PCC 7822 |
| 67 | 1482862 | 1483155 | + | NC_014501.1 | Gloeothece verrucosa PCC 7822 |
| 68 | 1810909 | 1811202 | + | NC_010296.1 | Microcystis aeruginosa NIES-843 |
| 69 | 1810076 | 1810369 | + | NC_010296.1 | Microcystis aeruginosa NIES-843 |
| 70 | 4216173 | 4216475 | + | NC_010296.1 | Microcystis aeruginosa NIES-843 |
| 71 | 2935188 | 2935484 | + | NC_010296.1 | Microcystis aeruginosa NIES-843 |
| 72 | 420830 | 421159 | - | NC_014534.1 | Gloeothece verrucosa PCC 7822 |
| 73 | 1335006 | 1335296 | + | NZ_CP042326.1 | Euhalothece natronophila Z-M001 |
| 74 | 2260721 | 2261008 | - | NZ_CP042326.1 | Euhalothece natronophila Z-M001 |
| 75 | 44243 | 44548 | - | NC_019776.1 | Cyanobacterium aponinum PCC 10605 |
| 76 | 35997 | 36242 | - | NC_019776.1 | Cyanobacterium aponinum PCC 10605 |
| 77 | 5609853 | 5610113 | - | NC_009925.1 | Acaryochloris marina MBIC11017 |
| 78 | 556808 | 557095 | + | NC_009925.1 | Acaryochloris marina MBIC11017 |
| 79 | 2656095 | 2656382 | + | NC_009925.1 | Acaryochloris marina MBIC11017 |
| 80 | 2014474 | 2014722 | + | NC_009925.1 | Acaryochloris marina MBIC11017 |
| 81 | 54743 | 55012 | - | NC_009926.1 | Acaryochloris marina MBIC11017 |
| 82 | 90919 | 91206 | - | NC_009926.1 | Acaryochloris marina MBIC11017 |
| 83 | 67539 | 67826 | - | NC_009926.1 | Acaryochloris marina MBIC11017 |
| 84 | 566 | 853 | + | NC_009929.1 | Acaryochloris marina MBIC11017 |
| 85 | 72752 | 73027 | - | NC_009928.1 | Acaryochloris marina MBIC11017 |
| 86 | 53557 | 53802 | - | NC_009928.1 | Acaryochloris marina MBIC11017 |
| 87 | 10409 | 10696 | + | NZ_CP042329.1 | Euhalothece natronophila Z-M001 |
| 88 | 977493 | 977771 | + | NZ_CP032101.1 | Malaciobacter marinus |
| 89 | 1007398 | 1007676 | + | NZ_CP042812.1 | Malaciobacter canalis |
| 90 | 8750838 | 8751098 | + | NZ_CP042425.1 | Limnoglobus roseus |
| 91 | 749122 | 749376 | - | NC_005090.1 | Wolinella succinogenes DSM 1740 |
| 92 | 2812016 | 2812300 | + | NZ_CP036299.1 | Planctopirus ephydatiae |
| 93 | 1894725 | 1895012 | + | NC_014148.1 | Planctopirus limnophila DSM 3776 |
| 94 | 911675 | 911953 | + | NZ_CP031218.1 | Malaciobacter halophilus |
| 95 | 335656 | 335925 | - | NZ_CP014230.1 | Desulfomicrobium orale DSM 12838 |
| 96 | 1463897 | 1464160 | - | NZ_CP014230.1 | Desulfomicrobium orale DSM 12838 |
| 97 | 3128565 | 3128849 | + | NC_013851.1 | Allochromatium vinosum DSM 180 |
| 98 | 339439 | 339714 | + | NC_013851.1 | Allochromatium vinosum DSM 180 |
| 99 | 1239096 | 1239350 | + | NC_012115.1 | Nautilia profundicola AmH |
| 100 | 7042045 | 7042338 | - | NZ_AP017422.1 | Filimonas lacunae |
| 101 | 1980185 | 1980463 | - | NC_014166.1 | Arcobacter nitrofigilis DSM 7299 |
| 102 | 5853819 | 5854124 | - | NZ_CP032157.1 | Paraflavitalea soli |
| 103 | 2124334 | 2124618 | + | NC_019940.1 | Thioflavicoccus mobilis 8321 |
| 104 | 455565 | 455843 | + | NC_007645.1 | Hahella chejuensis KCTC 2396 |
| 105 | 47747 | 48028 | + | NZ_CP032099.1 | Aliarcobacter skirrowii CCUG 10374 |
| 106 | 878238 | 878516 | + | NZ_CP032098.1 | Malaciobacter molluscorum LMG 25693 |
| 107 | 219183 | 219473 | + | NC_019675.1 | Cyanobium gracile PCC 6307 |
| 108 | 104286 | 104552 | + | NZ_CP032100.1 | Arcobacter suis CECT 7833 |
| 109 | 2275692 | 2275973 | - | NZ_CP054051.1 | Aliarcobacter cibarius |
| 110 | 2409432 | 2409677 | + | NZ_CP039543.1 | Desulfovibrio marinus |
| 111 | 2241083 | 2241346 | - | NZ_CP039543.1 | Desulfovibrio marinus |
| 112 | 1254638 | 1254913 | - | NZ_CP048878.1 | Spartinivicinus ruber |
| 113 | 1363184 | 1363459 | + | NZ_CP048878.1 | Spartinivicinus ruber |
| 114 | 1363979 | 1364254 | - | NZ_CP048878.1 | Spartinivicinus ruber |
| 115 | 1204383 | 1204658 | + | NZ_CP048878.1 | Spartinivicinus ruber |
| 116 | 1228040 | 1228291 | + | NC_016629.1 | Desulfocurvibacter africanus subsp. africanus str. Walvis Bay |
| 117 | 1182028 | 1182330 | - | NC_016629.1 | Desulfocurvibacter africanus subsp. africanus str. Walvis Bay |
| 118 | 2066000 | 2066305 | + | NC_016629.1 | Desulfocurvibacter africanus subsp. africanus str. Walvis Bay |
| 119 | 47631 | 47945 | + | NC_016629.1 | Desulfocurvibacter africanus subsp. africanus str. Walvis Bay |
| 120 | 3574706 | 3575023 | + | NC_017079.1 | Caldilinea aerophila DSM 14535 = NBRC 104270 |
| 121 | 3573032 | 3573307 | + | NC_014844.1 | Pseudodesulfovibrio aespoeensis Aspo-2 |
| 122 | 921691 | 921954 | + | NC_014844.1 | Pseudodesulfovibrio aespoeensis Aspo-2 |
| 123 | 2977159 | 2977422 | - | NC_014844.1 | Pseudodesulfovibrio aespoeensis Aspo-2 |
| 124 | 6975 | 7289 | + | NC_016609.1 | Niastella koreensis GR20-10 |
| 125 | 4025763 | 4026050 | - | NC_016609.1 | Niastella koreensis GR20-10 |
| 126 | 4337442 | 4337756 | - | NC_016609.1 | Niastella koreensis GR20-10 |
| 127 | 1793232 | 1793540 | + | NC_016609.1 | Niastella koreensis GR20-10 |
| 128 | 14228 | 14494 | + | NC_020127.1 | Lawsonia intracellularis N343 |
| 129 | 45777 | 46058 | + | NZ_CP036246.2 | [Arcobacter] porcinus |
| 130 | 124291 | 124557 | + | NZ_CP053840.1 | Arcobacter venerupis |
| 131 | 1438312 | 1438563 | - | NZ_CP036281.1 | Polystyrenella longa |
| 132 | 4613330 | 4613629 | + | NZ_CP037755.1 | Pseudocnuella soli |
| 133 | 814098 | 814361 | - | NC_007519.1 | Desulfovibrio alaskensis G20 |
| 134 | 2852159 | 2852434 | + | NZ_CP039268.1 | Thermochromatium tepidum ATCC 43061 |
| 135 | 1929712 | 1929990 | + | NZ_AP023212.1 | Hydrogenimonas urashimensis |
| 136 | 132827 | 133093 | + | NZ_CP042652.1 | Pseudoarcobacter acticola |
| 137 | 819235 | 819555 | - | NZ_LT906459.1 | Odoribacter splanchnicus |
| 138 | 1966347 | 1966628 | + | NZ_CP032823.1 | Aliarcobacter cryaerophilus ATCC 43158 |
| 139 | 127200 | 127466 | + | NZ_CP053835.1 | Arcobacter defluvii |
| 140 | 45723 | 45989 | - | NZ_CP031217.1 | Halarcobacter bivalviorum |
| 141 | 3169215 | 3169487 | - | NZ_CP007031.1 | Marichromatium purpuratum 984 |
| 142 | 2707992 | 2708294 | - | NZ_CP051774.1 | Luteolibacter luteus |
| 143 | 227117 | 227368 | - | NC_016633.1 | Sphaerochaeta pleomorpha str. Grapes |
| 144 | 107786 | 108052 | + | NZ_CP032097.1 | Arcobacter ellisii |
| 145 | 564277 | 564522 | - | NZ_AP018676.1 | Helicobacter cinaedi |
| 146 | 1344123 | 1344395 | - | NC_011059.1 | Prosthecochloris aestuarii DSM 271 |
| 147 | 593681 | 593932 | - | NZ_CP040463.1 | Caminibacter mediatlanticus TB-2 |
| 148 | 874550 | 874849 | - | NZ_AP017928.1 | Methylocaldum marinum |
| 149 | 3611511 | 3611798 | + | NZ_AP017928.1 | Methylocaldum marinum |
| 150 | 137342 | 137608 | - | NZ_CP014229.1 | Desulfovibrio fairfieldensis |
| 151 | 1055736 | 1056029 | + | NZ_CP026538.1 | Desulfovibrio carbinolicus |
| 152 | 3906948 | 3907241 | - | NC_012796.1 | Desulfovibrio magneticus RS-1 |
| 153 | 1631468 | 1631752 | + | NZ_CP040449.1 | Aeromonas simiae |
| 154 | 420370 | 420636 | + | NZ_CP046400.1 | Pseudodesulfovibrio cashew |
| 155 | 2314915 | 2315166 | + | NC_017310.1 | Desulfovibrio vulgaris RCH1 |
| 156 | 669066 | 669374 | + | NZ_CP035708.1 | Sphaerotilus natans subsp. sulfidivorans |
| 157 | 878372 | 878629 | - | NC_013173.1 | Desulfomicrobium baculatum DSM 4028 |
| 158 | 2414331 | 2414624 | - | NC_018018.1 | Bernardetia litoralis DSM 6794 |
| 159 | 961710 | 961997 | - | NC_018018.1 | Bernardetia litoralis DSM 6794 |
| 160 | 1707937 | 1708200 | - | NC_012881.1 | Maridesulfovibrio salexigens DSM 2638 |
| 161 | 1979468 | 1979779 | - | NZ_CP060714.1 | Diaphorobacter ruginosibacter |
| 162 | 1326481 | 1326765 | - | NC_013943.1 | Denitrovibrio acetiphilus DSM 12809 |
| 163 | 994998 | 995267 | - | NC_013943.1 | Denitrovibrio acetiphilus DSM 12809 |
| 164 | 1060188 | 1060436 | + | NZ_AP017378.1 | Desulfovibrio ferrophilus |
| 165 | 525108 | 525371 | + | NZ_AP017378.1 | Desulfovibrio ferrophilus |
| 166 | 1657835 | 1658098 | - | NZ_AP017378.1 | Desulfovibrio ferrophilus |
| 167 | 733482 | 733754 | + | NC_018012.1 | Thiocystis violascens DSM 198 |
| 168 | 2271530 | 2271835 | - | NC_013512.1 | Sulfurospirillum deleyianum DSM 6946 |
| 169 | 4240118 | 4240423 | - | NZ_CP069450.1 | Butyricimonas virosa |
| 170 | 2086920 | 2087177 | - | NC_014008.1 | Coraliomargarita akajimensis DSM 45221 |
| 171 | 1402871 | 1403146 | - | NZ_CP045508.1 | Desulfolutivibrio sulfoxidireducens |
| 172 | 624992 | 625237 | - | NZ_LN907858.1 | Helicobacter typhlonius |
| 173 | 1359192 | 1359440 | - | NZ_CP010995.1 | Campylobacter iguaniorum |
| 174 | 2573321 | 2573581 | + | NC_016803.1 | Pseudodesulfovibrio mercurii |
| 175 | 1208206 | 1208472 | - | NC_016803.1 | Pseudodesulfovibrio mercurii |
| 176 | 170530 | 170796 | + | NZ_CP053836.1 | Halarcobacter ebronensis |
| 177 | 3438328 | 3438636 | + | NC_014933.1 | Bacteroides helcogenes P 36-108 |
| 178 | 4339131 | 4339412 | + | NC_014364.1 | Sediminispirochaeta smaragdinae DSM 11293 |
| 179 | 2494547 | 2494828 | - | NC_014364.1 | Sediminispirochaeta smaragdinae DSM 11293 |
| 180 | 4366600 | 4366866 | - | NC_014364.1 | Sediminispirochaeta smaragdinae DSM 11293 |
| 181 | 2018601 | 2018864 | + | NC_013223.1 | Desulfohalobium retbaense DSM 5692 |
| 182 | 543327 | 543575 | + | NZ_CP053828.1 | Campylobacter hyointestinalis subsp. lawsonii |
| 183 | 3378738 | 3379025 | + | NC_006177.1 | Symbiobacterium thermophilum IAM 14863 |
| 184 | 3060651 | 3060893 | - | NC_006177.1 | Symbiobacterium thermophilum IAM 14863 |
| 185 | 1232262 | 1232510 | - | NZ_CP059443.1 | Campylobacter fetus |
| 186 | 4569118 | 4569363 | + | NZ_LN877293.1 | Bacteroides fragilis |
| 187 | 2572255 | 2572500 | - | NZ_LN877293.1 | Bacteroides fragilis |
| 188 | 416789 | 417088 | + | NZ_CP043575.1 | Comamonas koreensis |
| 189 | 5814001 | 5814297 | - | NC_019892.1 | Singulisphaera acidiphila DSM 18658 |
| 190 | 1553874 | 1554188 | - | NZ_CP042435.1 | Panacibacter ginsenosidivorans |
| 191 | 367928 | 368203 | - | NZ_CP011971.1 | Steroidobacter denitrificans |
| 192 | 2225079 | 2225345 | + | NZ_LT907975.1 | Pseudodesulfovibrio profundus |
| 193 | 624229 | 624471 | - | NC_015318.1 | Hippea maritima DSM 10411 |
| 194 | 3142623 | 3142901 | + | NC_015152.1 | Sphaerochaeta globosa str. Buddy |
| 195 | 1199912 | 1200196 | + | NZ_CP019633.1 | Sedimentisphaera cyanobacteriorum |
| 196 | 2201052 | 2201333 | - | NZ_CP053837.1 | Aliarcobacter faecis |
| 197 | 316541 | 316792 | + | NC_004917.1 | Helicobacter hepaticus ATCC 51449 |
| 198 | 462715 | 462960 | + | NZ_CP019684.1 | Campylobacter sputorum bv. paraureolyticus LMG 11764 |
| 199 | 320005 | 320250 | - | NZ_CP015401.2 | Bacteroides caecimuris |
| 200 | 2116875 | 2117120 | - | NZ_CP015401.2 | Bacteroides caecimuris |
| 201 | 2041274 | 2041519 | - | NC_014734.1 | Paludibacter propionicigenes WB4 |
| 202 | 3293471 | 3293737 | + | NZ_CP017476.1 | Hydrogenophaga crassostreae |
| 203 | 227354 | 227620 | + | NC_021291.1 | Spiribacter salinus M19-40 |
| 204 | 906459 | 906749 | + | NZ_CP036278.1 | Aeoliella mucimassa |
| 205 | 1039792 | 1040037 | - | NZ_CP012938.1 | Bacteroides ovatus |
| 206 | 5142832 | 5143077 | - | NZ_CP012938.1 | Bacteroides ovatus |
| 207 | 2609344 | 2609628 | - | NZ_CP021023.1 | Sedimentisphaera salicampi |
| 208 | 1859386 | 1859655 | + | NZ_CP011125.1 | Sandaracinus amylolyticus |
| 209 | 1837416 | 1837721 | + | NC_017583.1 | Spirochaeta thermophila DSM 6578 |
| 210 | 1374009 | 1374293 | + | NC_017583.1 | Spirochaeta thermophila DSM 6578 |
| 211 | 243601 | 243861 | + | NC_022664.1 | Spiribacter curvatus |
| 212 | 29275 | 29556 | - | NZ_CP031367.1 | Aliarcobacter trophiarum LMG 25534 |
| 213 | 728247 | 728534 | - | NC_010729.1 | Porphyromonas gingivalis ATCC 33277 |
| 214 | 2613232 | 2613486 | - | NZ_CP007032.1 | Desulfitobacterium metallireducens DSM 15288 |
| 215 | 621077 | 621331 | + | NZ_CP046996.1 | Dehalobacter restrictus |
| 216 | 2672391 | 2672648 | - | NZ_CP019698.1 | Desulfotomaculum ferrireducens |
| 217 | 1074727 | 1074996 | - | NZ_CP015772.1 | Niabella ginsenosidivorans |
| 218 | 186424 | 186669 | + | NC_013385.1 | Ammonifex degensii KC4 |
| 219 | 4596143 | 4596394 | - | NC_011830.1 | Desulfitobacterium hafniense DCB-2 |
| 220 | 2738813 | 2739070 | - | NC_009253.1 | Desulfotomaculum reducens MI-1 |
| 221 | 3307756 | 3308004 | - | NC_021184.1 | Desulfoscipio gibsoniae DSM 7213 |
| 222 | 262674 | 262925 | + | NC_017098.1 | Spirochaeta africana DSM 8902 |
++ More..