Result : Q9WW67
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein TM_1323/TM_1333 |
| NCBI Accession ID | AE000512.1 |
| Organism | Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) |
| Left | 1342647 |
| Right | 1342829 |
| Strand | + |
| Nucleotide Sequence | ATGATAATCTTTTTGATACTCGTTCTCCTGTCTACAATCATTTTCGCTGACAAAGTGAAGACAGATAACGAAACGCATTCCTGGAAAAGTGAGATTACGGAACAGGTTCAGGTTGCACCCAAAAGTGCAGCTACTTGTGAGGTTACTTTCAAAGGTTCAACTGCTGGAAATCAGAGTTTTTAA |
| Sequence | MIIFLILVLLSTIIFADKVKTDNETHSWKSEITEQVQVAPKSAATCEVTFKGSTAGNQSF |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 10360571 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | Q9WW67 |
| ORF Length (Amino Acid) | 60 |
++ More..
| Conservation Analysis |
No. of Species: 4
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1463663 | 1463845 | - | NC_013642.1 | Thermotoga naphthophila RKU-10 |
| 2 | 1439413 | 1439595 | - | NC_009486.1 | Thermotoga petrophila RKU-1 |
| 3 | 1472422 | 1472604 | - | NC_023151.1 | Thermotoga maritima MSB8 |
| 4 | 1462394 | 1462576 | - | NC_023151.1 | Thermotoga maritima MSB8 |
| 5 | 1078569 | 1078751 | - | NC_011978.1 | Thermotoga neapolitana DSM 4359 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_013642.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF07690.18 | 1.0 | 4 | 4110.0 | same-strand | Major Facilitator Superfamily |
| 2 | PF12832.9 | 1.0 | 4 | 4110.0 | same-strand | MFS 1 like family |
| 3 | PF19864.1 | 1.0 | 4 | 389.0 | same-strand | Radical SAM proteins, N-terminal |
| 4 | PF04055.23 | 1.0 | 4 | 389 | same-strand | Radical SAM superfamily |
| 5 | PF01381.24 | 0.75 | 3 | 2273 | same-strand | Helix-turn-helix |
| 6 | PF13744.8 | 0.75 | 3 | 2273 | same-strand | Helix-turn-helix domain |
| 7 | PF13560.8 | 0.75 | 3 | 2273 | same-strand | Helix-turn-helix domain |
| 8 | PF00005.29 | 0.75 | 3 | 3134 | same-strand | ABC transporter |
| 9 | PF00664.25 | 0.75 | 3 | 3134 | same-strand | ABC transporter transmembrane region |
++ More..