Result : Q9S4X1
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YubE |
| NCBI Accession ID | AF106329.1 |
| Organism | Escherichia coli (strain K12) |
| Left | 2004 |
| Right | 2225 |
| Strand | + |
| Nucleotide Sequence | ATGAACTATGCCGGACATAAAAAACTTCGCGCCGACGTGGCGGAGGTGGCCAACACCATGTGTGACCTTCGGGCCAGGCTGAACGATATGGAGCATCGCTGTCGCTTTGATTCCGATGTGCTTGTTGAACGCCTGGCACGCCAGACGCTGTATCGCGCCAATCGCCTGTTCATGGAGGCGTATACCGAAATTCTGGAACTGGATGCGTGCTTTAAAGATTGA |
| Sequence | MNYAGHKKLRADVAEVANTMCDLRARLNDMEHRCRFDSDVLVERLARQTLYRANRLFMEAYTEILELDACFKD |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 10366527 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | Q9S4X1 |
| ORF Length (Amino Acid) | 73 |
++ More..
| Conservation Analysis |
No. of Species: 13
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 40047 | 40268 | + | NC_002128.1 | Escherichia coli O157:H7 str. Sakai |
| 2 | 74805 | 75026 | + | NZ_CP045204.1 | Citrobacter telavivensis |
| 3 | 32760 | 32981 | - | NZ_CP026049.1 | Raoultella planticola |
| 4 | 17959 | 18180 | + | NZ_CP057659.1 | Escherichia fergusonii |
| 5 | 165211 | 165432 | + | NC_004851.1 | Shigella flexneri 2a str. 301 |
| 6 | 64379 | 64603 | - | NZ_CP017185.1 | Enterobacter roggenkampii |
| 7 | 50160 | 50381 | + | NC_003277.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 8 | 790 | 1011 | - | NZ_CP034939.1 | Pectobacterium odoriferum |
| 9 | 78660 | 78881 | - | NZ_CP011600.1 | Phytobacter ursingii |
| 10 | 90330 | 90551 | + | NZ_CP045770.1 | Enterobacter cancerogenus |
| 11 | 42473 | 42694 | + | NZ_CP043319.1 | Enterobacter chengduensis |
| 12 | 64578 | 64799 | - | NZ_CP050151.1 | Hafnia alvei |
| 13 | 37177 | 37398 | + | NC_015963.1 | Enterobacter soli |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_002128.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01555.20 | 0.62 | 8 | 0.0 | same-strand | DNA methylase |
| 2 | PF07128.14 | 0.92 | 12 | 49.0 | same-strand | Protein of unknown function (DUF1380) |
| 3 | PF03230.15 | 0.62 | 8 | 1563.0 | same-strand | Antirestriction protein |
++ More..