ProsmORF-pred
Result : Q9S2H6
Protein Information
Information Type Description
Protein name PTS system N-acetylglucosamine-specific EIIB component (PTS system GlcNAc-specific EIIB component) (EC 2.7.1.193) (N-acetylglucosamine-specific phosphotransferase enzyme IIB component) (GlcNAc-specific phosphotransferase enzyme IIB component)
NCBI Accession ID AL939114.1
Organism Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Left 122865
Right 123098
Strand -
Nucleotide Sequence ATGGCCAGCAAGGCTGAGAAGATCGTCGCCGGCCTCGGCGGCATCGACAACATCGACGAGATCGAAGGCTGCATCACCCGACTCCGCACCGAGGTCAACGACCCCGCGCTGGTCAACGAAGCCGCCCTCAAGGCCGCCGGCGCCCACGGCGTCGTCAAGATGGGCACCGCCATCCAGGTCGTCATCGGCACCGACGCCGACCCGATCGCGGCGGAGATCGAAGACATGATGTGA
Sequence MASKAEKIVAGLGGIDNIDEIEGCITRLRTEVNDPALVNEAALKAAGAHGVVKMGTAIQVVIGTDADPIAAEIEDMM
Source of smORF Swiss-Prot
Function The phosphoenolpyruvate-dependent sugar phosphotransferase system (sugar PTS), a major carbohydrate active transport system, catalyzes the phosphorylation of incoming sugar substrates concomitantly with their translocation across the cell membrane. This system is involved in N-acetylglucosamine (GlcNAc) transport. {ECO:0000269|Pubmed:20487300}.
Pubmed ID 12000953 20487300
Domain CDD:421868
Functional Category Others
Uniprot ID Q9S2H6
ORF Length (Amino Acid) 77
++ More..
Conservation Analysis
Conservation Analysis
No. of Species: 186
Sr.No. Left Position Right Position Strand NCBI Accession id Species Name
1 2716750 2716983 - NZ_CP015866.1 Streptomyces parvulus
2 3107660 3107893 - NZ_CP012382.1 Streptomyces ambofaciens ATCC 23877
3 2799222 2799455 - NZ_CP072827.1 Streptomyces mobaraensis NBRC 13819 = DSM 40847
4 5396935 5397168 + NZ_CP051006.1 Streptomyces griseofuscus
5 4632455 4632688 + NZ_CP034279.1 Streptomyces ficellus
6 3965575 3965808 - NZ_CP023690.1 Streptomyces spectabilis
7 6321820 6322053 + NC_013929.1 Streptomyces scabiei 87.22
8 5905642 5905875 + NZ_CP023688.1 Streptomyces rimosus
9 3896671 3896904 - NZ_CP034539.1 Streptomyces cyaneochromogenes
10 2900750 2900983 - NZ_CP072931.1 Streptomyces auratus AGR0001
11 3508836 3509069 - NZ_CP071839.1 Streptomyces cyanogenus
12 2774095 2774328 - NZ_CP029043.1 Streptomyces nigra
13 2750387 2750620 - NZ_CP040752.1 Streptomyces rectiverticillatus
14 5421893 5422126 + NZ_CP026652.1 Streptomyces dengpaensis
15 6058065 6058298 + NZ_CP017248.1 Streptomyces fodineus
16 5978581 5978814 - NZ_CP030862.1 Streptomyces globosus
17 3500358 3500591 - NC_021985.1 Streptomyces collinus Tu 365
18 2278113 2278346 - NZ_CP032229.1 Streptomyces seoulensis
19 5862291 5862524 + NZ_CP032427.1 Streptomyces griseorubiginosus
20 2866736 2866969 - NZ_CP013738.1 Streptomyces globisporus C-1027
21 6105467 6105700 + NZ_CP023689.1 Streptomyces chartreusis
22 2935923 2936156 - NZ_CP023407.1 Streptomyces fungicidicus
23 3215465 3215698 - NZ_CP010407.1 Streptomyces vietnamensis
24 2250488 2250721 - NZ_CP017316.1 Streptomyces rubrolavendulae
25 2394612 2394845 - NZ_CP023696.1 Streptomyces fradiae ATCC 10745 = DSM 40063
26 9695653 9695886 - NZ_CP016279.1 Streptomyces griseochromogenes
27 5402345 5402578 + NZ_CP011340.1 Streptomyces pristinaespiralis
28 1411148 1411381 + NZ_CP063373.1 Streptomyces ferrugineus
29 4316890 4317123 - NZ_CP034463.1 Streptomyces aquilus
30 6323093 6323326 + NZ_CP023699.1 Streptomyces kanamyceticus
31 4822441 4822674 + NZ_CP023698.1 Streptomyces viridifaciens
32 3575888 3576121 - NZ_CP022685.1 Streptomyces formicae
33 3486330 3486563 - NZ_CP027306.1 Streptomyces atratus
34 7243739 7243972 - NZ_CP051486.1 Streptomyces pratensis
35 5816857 5817090 + NZ_CP060404.1 Streptomyces buecherae
36 4547915 4548148 + NZ_CP023202.1 Streptomyces xinghaiensis S187
37 4328674 4328907 + NZ_CP022744.1 Streptomyces lincolnensis
38 3915608 3915841 - NZ_CP047020.1 Streptomyces broussonetiae
39 4745970 4746203 + NZ_CP023701.1 Streptomyces subrutilus
40 4121684 4121917 - NZ_CP031455.1 Streptomyces olivoreticuli subsp. olivoreticuli
41 3066592 3066825 - NZ_CP010849.1 Streptomyces cyaneogriseus subsp. noncyanogenus
42 5130289 5130522 + NZ_LN831790.1 Streptomyces leeuwenhoekii
43 3479903 3480136 - NZ_CP015098.1 Streptomyces qaidamensis
44 2707246 2707479 - NZ_CP070242.1 Streptomyces californicus
45 2695332 2695565 - NZ_CP020570.1 Streptomyces violaceoruber
46 5446560 5446793 + NC_010572.1 Streptomyces griseus subsp. griseus NBRC 13350
47 4078301 4078534 - NZ_CP070326.1 Streptomyces noursei
48 3429870 3430103 - NZ_CP059991.1 Streptomyces gardneri
49 3365689 3365922 - NZ_CP023691.1 Streptomyces platensis
50 6276799 6277032 + NC_003155.5 Streptomyces avermitilis MA-4680 = NBRC 14893
51 3293060 3293293 - NZ_CP019457.1 Streptomyces lydicus
52 3159904 3160137 - NC_016109.1 Kitasatospora setae KM-6054
53 2922592 2922825 - NZ_CP023693.1 Streptomyces cinereoruber
54 4850604 4850837 + NZ_CP022310.1 Streptomyces calvus
55 3638174 3638407 - NZ_CP023694.1 Streptomyces coeruleorubidus
56 3710856 3711089 - NZ_CP045096.1 Streptomyces phaeolivaceus
57 2526419 2526652 - NZ_CP031742.1 Streptomyces koyangensis
58 2044967 2045200 - NC_016111.1 Streptomyces cattleya NRRL 8057 = DSM 46488
59 2776219 2776452 - NZ_AP023439.1 Streptomyces tuirus
60 5367715 5367948 + NZ_CP032698.1 Streptomyces hundungensis
61 2100753 2100986 - NC_020990.1 Streptomyces albidoflavus
62 3403760 3403993 - NZ_CP021978.1 Streptomyces hawaiiensis
63 2752321 2752554 - NZ_CP029196.1 Streptomyces venezuelae
64 2824660 2824893 - NC_021177.1 Streptomyces fulvissimus DSM 40593
65 2606851 2607084 - NZ_CP020563.1 Kitasatospora albolonga
66 8031082 8031315 + NC_016582.1 Streptomyces bingchenggensis BCW-1
67 2523290 2523523 - NZ_CP024957.1 Streptomyces cavourensis
68 5395764 5395997 + NZ_CP034687.1 Streptomyces griseoviridis
69 4899315 4899548 + NZ_CP023702.1 Streptomyces nitrosporeus
70 2515752 2515985 - NZ_CP021080.1 Streptomyces pluripotens
71 2959950 2960183 - NZ_CP023695.1 Streptomyces alboniger
72 5743953 5744186 + NZ_CP045643.1 Streptomyces fagopyri
73 2150194 2150427 - NZ_CP029188.1 Streptomyces tirandamycinicus
74 1827702 1827935 - NZ_CP029254.1 Streptomyces spongiicola
75 5949338 5949571 + NZ_AP023440.1 Streptomyces glomeroaurantiacus
76 5101077 5101310 + NZ_CP048882.1 Streptomyces bathyalis
77 3656867 3657100 - NZ_CP020569.1 Streptomyces gilvosporeus
78 3731944 3732177 - NZ_CP071139.1 Streptomyces nojiriensis
79 3138102 3138335 - NZ_CP063374.1 Streptomyces chromofuscus
80 3041990 3042223 - NZ_CP023703.1 Streptomyces galilaeus
81 2304013 2304246 - NZ_CP031264.1 Streptacidiphilus bronchialis
82 5537425 5537658 + NZ_CP030073.1 Streptomyces cadmiisoli
83 4489734 4489967 + NZ_CP065253.1 Streptomyces clavuligerus
84 4668164 4668397 + NZ_CP023692.1 Streptomyces vinaceus
85 2696404 2696637 - NZ_CP020700.1 Streptomyces tsukubensis
86 4715804 4716037 - NZ_CP065050.1 Streptomyces solisilvae
87 2447589 2447822 - NZ_CP031194.1 Streptomyces paludis
88 2582092 2582325 - NZ_CP042266.1 Streptomyces qinzhouensis
89 4388582 4388815 + NZ_CP059164.1 Nocardioides ungokensis
90 1345823 1346056 - NZ_CP047156.1 Epidermidibacterium keratini
91 1627270 1627500 - NC_021064.1 Cutibacterium avidum 44067
92 745136 745366 + NC_006085.1 Cutibacterium acnes KPA171202
93 2781533 2781763 + NZ_LR134352.1 Nocardia asteroides
94 1522167 1522400 - NZ_LN849456.1 Devriesea agamarum
95 3501737 3501967 - NZ_AP017900.1 Nocardia seriolae
96 4098095 4098325 + NZ_AP023172.1 Rhodococcus qingshengii
97 3431804 3432037 - NZ_CP016282.1 Cryobacterium arcticum
98 5418719 5418955 - NZ_CP008953.1 Amycolatopsis japonica
99 3334352 3334585 + NZ_CP030033.1 Cryobacterium soli
100 3795476 3795706 + NZ_CP041695.1 Nocardia otitidiscaviarum
101 3260356 3260592 + NZ_CP016174.1 Amycolatopsis orientalis
102 1751589 1751819 + NZ_CP066802.1 Actinomyces weissii
103 2901393 2901629 + NC_021252.1 Amycolatopsis keratiniphila
104 3530189 3530419 + NC_015564.1 Hoyosella subflava DQS3-9A1
105 1490387 1490623 + NC_013595.1 Streptosporangium roseum DSM 43021
106 3345890 3346099 - NZ_CP015235.1 Rhodococcus fascians D188
107 1413588 1413818 + NZ_LR134357.1 Actinomyces israelii
108 959038 959274 + NZ_CP015163.1 Amycolatopsis albispora
109 1939147 1939377 - NZ_CP014228.1 Actinomyces radicidentis
110 1935825 1936055 + NZ_CP014228.1 Actinomyces radicidentis
111 1906034 1906264 - NZ_AP018920.1 Pseudonocardia autotrophica
112 349151 349384 - NZ_AP018920.1 Pseudonocardia autotrophica
113 8159784 8160020 - NZ_CP012752.1 Kibdelosporangium phytohabitans
114 1903182 1903412 + NZ_CP018082.1 Nocardia mangyaensis
115 7071809 7072045 - NC_019673.1 Saccharothrix espanaensis DSM 44229
116 771769 771978 - NZ_CP017812.1 Boudabousia tangfeifanii
117 615361 615591 + NZ_CP066049.1 Actinomyces naeslundii
118 618816 619043 - NZ_CP066049.1 Actinomyces naeslundii
119 648791 649021 - NZ_CP066060.1 Actinomyces oris
120 645307 645534 + NZ_CP066060.1 Actinomyces oris
121 183073 183303 + NZ_CP045529.1 Luteimicrobium xylanilyticum
122 182759 183004 + NZ_CP045529.1 Luteimicrobium xylanilyticum
123 9699388 9699624 - NZ_CP016793.1 Lentzea guizhouensis
124 1455509 1455739 + NZ_LR134477.1 Actinomyces viscosus
125 1458986 1459213 - NZ_LR134477.1 Actinomyces viscosus
126 2924565 2924804 + NC_022116.1 Amycolatopsis mediterranei RB
127 2296204 2296434 - NZ_CP035495.1 Xylanimonas allomyrinae
128 374416 374649 + NZ_CP035495.1 Xylanimonas allomyrinae
129 8697892 8698128 - NZ_CP034550.1 Saccharothrix syringae
130 1922195 1922431 + NZ_CP045929.1 Saccharopolyspora coralli
131 2485486 2485716 - NZ_CP033325.1 Georgenia faecalis
132 2486343 2486540 - NZ_CP033325.1 Georgenia faecalis
133 1388341 1388577 + NZ_CP045572.1 Nonomuraea nitratireducens
134 3006325 3006561 + NZ_CP007155.1 Kutzneria albida DSM 43870
135 1584634 1584870 + NC_013159.1 Saccharomonospora viridis DSM 43017
136 1583290 1583520 + NZ_CP060713.1 Nocardioides mesophilus
137 5519577 5519813 - NZ_CP022753.1 Nocardiopsis gilva YIM 90087
138 9409565 9409795 + NC_013131.1 Catenulispora acidiphila DSM 44928
139 946157 946387 - NZ_CP041694.1 Cellulosimicrobium cellulans
140 946514 946705 - NZ_CP041694.1 Cellulosimicrobium cellulans
141 864090 864296 + NZ_CP019066.1 Tsukamurella tyrosinosolvens
142 85769 85999 - NZ_CP012507.1 Kocuria palustris
143 1511014 1511244 + NC_014151.1 Cellulomonas flavigena DSM 20109
144 1874413 1874649 - NZ_CP032788.1 Corynebacterium xerosis
145 2841775 2842011 - NZ_LR134501.1 Nocardiopsis dassonvillei
146 2413465 2413695 - NC_015671.1 Cellulomonas gilvus ATCC 13127
147 1181831 1182064 + NC_013530.1 Xylanimonas cellulosilytica DSM 15894
148 1831848 1832078 + NZ_CP053642.1 Actinomyces marmotae
149 1835059 1835289 - NZ_CP053642.1 Actinomyces marmotae
150 1219974 1220165 - NZ_CP014209.1 Isoptericola dokdonensis DS-3
151 1152641 1152874 + NC_015588.1 Isoptericola variabilis 225
152 811295 811501 + NC_014158.1 Tsukamurella paurometabola DSM 20162
153 1518277 1518507 + NC_015514.1 Cellulomonas fimi ATCC 484
154 1536752 1536982 + NC_015514.1 Cellulomonas fimi ATCC 484
155 1536490 1536720 + NC_015514.1 Cellulomonas fimi ATCC 484
156 2501390 2501620 - NZ_CP039291.1 Cellulomonas shaoxiangyii
157 4601754 4601987 - NC_013510.1 Thermomonospora curvata DSM 43183
158 2348432 2348662 - NZ_CP051884.1 Cellulomonas taurus
159 1025051 1025281 + NZ_CP051884.1 Cellulomonas taurus
160 4432113 4432343 - NZ_CP026746.1 Nocardia cyriacigeorgica
161 1708598 1708825 + NZ_LR134363.1 Actinomyces slackii
162 2745044 2745274 - NC_013521.1 Sanguibacter keddieii DSM 10542
163 6170154 6170390 - NZ_CP023445.1 Actinosynnema pretiosum
164 6256172 6256408 - NC_013093.1 Actinosynnema mirum DSM 43827
165 54535 54747 - NZ_CP040428.1 Jejubacter calystegiae
166 1691543 1691782 + NZ_CP009245.1 Corynebacterium aquilae DSM 44791
167 385906 386145 - NC_006177.1 Symbiobacterium thermophilum IAM 14863
168 1048828 1049058 + NZ_CP039292.1 Actinomyces procaprae
169 1021483 1021713 + NZ_LR134350.1 Actinomyces howellii
170 1024753 1024983 - NZ_LR134350.1 Actinomyces howellii
171 1958111 1958338 - NZ_CP025227.1 Actinomyces wuliandei
172 2037748 2037993 + NC_014831.1 Thermaerobacter marianensis DSM 12885
173 1152512 1152745 + NZ_LT906441.1 Cutibacterium granulosum
174 1791527 1791739 - NC_015519.1 Tepidanaerobacter acetatoxydans Re1
175 2248744 2248980 + NC_009142.1 Saccharopolyspora erythraea NRRL 2338
176 990679 990888 + NZ_LS483423.1 Jonesia denitrificans
177 301433 301666 + NZ_CP016843.1 Carnobacterium divergens
178 2180157 2180390 - NZ_CP016843.1 Carnobacterium divergens
179 4003508 4003714 + NZ_CP014136.1 Gibbsiella quercinecans
180 546882 547112 - NZ_CP020468.1 Actinomyces gaoshouyii
181 543680 543910 + NZ_CP020468.1 Actinomyces gaoshouyii
182 161403 161675 - NZ_CP023643.1 Brochothrix thermosphacta
183 1761645 1761863 - NC_008148.1 Rubrobacter xylanophilus DSM 9941
184 4315312 4315548 - NZ_CP016353.1 Prauserella marina
185 1999322 1999513 - NC_015555.1 Thermoanaerobacterium xylanolyticum LX-11
186 554122 554358 + NZ_CP047602.1 Thermoanaerobacterium aotearoense
187 1651338 1651562 - NZ_CP031115.1 Rubrobacter indicoceani
188 1804579 1804839 + NZ_CP005973.1 Photobacterium gaetbulicola Gung47
189 482767 482982 + NC_003869.1 Caldanaerobacter subterraneus subsp. tengcongensis MB4
190 411008 411244 - NZ_CP071883.1 Curtobacterium flaccumfaciens pv. flaccumfaciens
191 1556898 1557110 + NZ_CP022358.1 Shewanella bicestrii
192 2932648 2932878 - NC_012669.1 Beutenbergia cavernae DSM 12333
193 624760 624963 + NC_008709.1 Psychromonas ingrahamii 37
194 822426 822644 + NZ_CP013984.1 Bacillus inaquosorum
195 1161008 1161226 - NZ_CP029364.1 Bacillus halotolerans
196 3069551 3069775 - NZ_CP041036.1 Shewanella polaris
197 3487986 3488210 - NZ_CP034015.1 Shewanella livingstonensis
198 1030085 1030303 + NZ_CP033052.1 Bacillus vallismortis
199 841796 842014 + NC_000964.3 Bacillus subtilis subsp. subtilis str. 168
200 2822414 2822653 + NZ_CP023525.1 Cedecea neteri
201 775720 775938 + NZ_CP048852.1 Bacillus tequilensis
202 3476479 3476715 - NZ_CP022752.1 Actinopolyspora erythraea
++ More..
Neighborhood Conservation Analysis
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Conservation Analysis
Neighborhood Representative Chosen(Species): NZ_CP015866.1
Sr.No. Domain Co-occurrence Frequency No. of species in which domain occurs with smORF Median distance b/w smORF and domain bearing ORFs Orientation relative to smORF PFAM Information
1 PF02378.20 0.8 149 1003.0 opposite-strand Phosphotransferase system, EIIC
++ More..