ProsmORF-pred
Result : Q9S0K8
Protein Information
Information Type Description
Protein name Phosphocarrier protein NPr (Nitrogen-related HPr)
NCBI Accession ID AB033988.1
Organism Shewanella violacea (strain JCM 10179 / CIP 106290 / LMG 19151 / DSS12)
Left 4021
Right 4296
Strand +
Nucleotide Sequence ATGACTAAATTAGAACGTCAGGTCACCATATGCAATAAACTCGGCCTCCATGCCCGAGCTGCGACTAAACTCGCCATCTTGGCTTCGGAATTTGACGCCGAGATAACCATAGTGCAGGGAGAGAAAAAAGCCTCAGCTGCCAGCGTATTAGGCCTGTTGATGCTAGAGACTGGCATGGGGAAAACCATCACTCTACTCGGTAAGGGTCAGGATGCCGATGCCGCACTCGATGCAATATGTGCCCTGGTCGATGCCAAATTCGATGAAGCGAGTTAA
Sequence MTKLERQVTICNKLGLHARAATKLAILASEFDAEITIVQGEKKASAASVLGLLMLETGMGKTITLLGKGQDADAALDAICALVDAKFDEAS
Source of smORF Swiss-Prot
Function Component of the phosphoenolpyruvate-dependent nitrogen-metabolic phosphotransferase system (nitrogen-metabolic PTS), that seems to be involved in regulating nitrogen metabolism. The phosphoryl group from phosphoenolpyruvate (PEP) is transferred to the phosphoryl carrier protein NPr by enzyme I-Ntr. Phospho-NPr then transfers it to EIIA-Ntr. Could function in the transcriptional regulation of sigma-54 dependent operons in conjunction with the NPr (PtsO) and EIIA-Ntr (PtsN) proteins. {ECO:0000250}.
Pubmed ID 10760597 20458400
Domain CDD:412221
Functional Category Others
Uniprot ID Q9S0K8
ORF Length (Amino Acid) 91
++ More..
Conservation Analysis
Conservation Analysis
No. of Species: 102
Sr.No. Left Position Right Position Strand NCBI Accession id Species Name
1 479551 479826 - NC_014012.1 Shewanella violacea DSS12
2 5856702 5856977 + NZ_CP014782.1 Shewanella psychrophila
3 5144538 5144813 + NC_010506.1 Shewanella woodyi ATCC 51908
4 868538 868813 - NC_009831.1 Shewanella sediminis HAW-EB3
5 3976566 3976841 + NZ_CP022358.1 Shewanella bicestrii
6 861853 862128 - NC_016901.1 Shewanella baltica OS678
7 3954682 3954957 + NC_009092.1 Shewanella loihica PV-4
8 3707377 3707652 + NZ_CP022272.1 Shewanella marisflavi
9 679227 679502 - NC_011566.1 Shewanella piezotolerans WP3
10 843168 843443 - NZ_CP046378.1 Shewanella algae
11 4507237 4507512 + NC_010334.1 Shewanella halifaxensis HAW-EB4
12 4410427 4410702 + NC_009901.1 Shewanella pealeana ATCC 700345
13 558779 559054 - NC_007954.1 Shewanella denitrificans OS217
14 5049583 5049858 + NZ_CP037952.1 Parashewanella spongiae
15 3593707 3593982 + NZ_CP069213.1 Shewanella litorisediminis
16 3666587 3666862 + NC_008700.1 Shewanella amazonensis SB2B
17 4026162 4026437 + NC_008345.1 Shewanella frigidimarina NCIMB 400
18 340919 341194 + NZ_CP037951.1 Parashewanella tropica
19 4409938 4410213 + NZ_CP034015.1 Shewanella livingstonensis
20 3405639 3405914 + NZ_CP020373.1 Shewanella khirikhana
21 4017715 4017990 + NZ_CP041036.1 Shewanella polaris
22 4301806 4302078 + NZ_CP020472.1 Shewanella japonica
23 1599317 1599586 + NZ_CP036200.1 Shewanella maritima
24 3889903 3890172 + NC_014541.1 Ferrimonas balearica DSM 9799
25 1177733 1177978 + NZ_CP052766.1 Alteromonas pelagimontana
26 3415478 3415744 + NZ_CP036536.1 Salinimonas lutimaris
27 714663 714935 - NZ_CP031769.1 Salinimonas sediminis
28 2661899 2662171 + NZ_CP029347.1 Saliniradius amylolyticus
29 914474 914710 - NZ_CP014322.1 Alteromonas addita
30 3300218 3300454 + NC_015554.1 Alteromonas naphthalenivorans
31 798296 798565 - NZ_CP072844.1 Psychrosphaera aestuarii
32 3224437 3224712 + NC_012691.1 Tolumonas auensis DSM 9187
33 363718 363957 - NZ_CP039700.1 Vibrio cyclitrophicus
34 412987 413262 - NC_006512.1 Idiomarina loihiensis L2TR
35 858264 858509 - NZ_CP008849.1 Alteromonas australica
36 2216469 2216747 - NZ_CP046793.1 Vibrio metschnikovii
37 465586 465816 + NZ_CP009888.1 Pseudoalteromonas piratica
38 2994792 2995058 - NZ_CP034759.1 Litorilituus sediminis
39 2924201 2924440 + NC_011753.2 Vibrio atlanticus
40 2791446 2791724 + NZ_CP045350.1 Vibrio aquimaris
41 455586 455819 - NZ_CP044069.1 Vibrio vulnificus
42 315481 315759 - NZ_CP009354.1 Vibrio tubiashii ATCC 19109
43 74440 74718 + NZ_CP040990.1 Vibrio furnissii
44 4798082 4798318 + NC_003910.7 Colwellia psychrerythraea 34H
45 2800342 2800575 + NZ_CP030788.1 Vibrio campbellii
46 1837363 1837602 - NZ_CP065150.1 Vibrio kanaloae
47 874917 875192 - NC_013456.1 Vibrio antiquarius
48 338270 338545 - NZ_CP071325.1 Photobacterium ganghwense
49 449272 449526 - NZ_CP031781.1 Vibrio parahaemolyticus
50 2004026 2004301 + NZ_AP018689.1 Vibrio aphrogenes
51 245113 245388 - NZ_CP018312.1 Vibrio rotiferianus
52 2279921 2280154 - NZ_CP019959.1 Vibrio owensii
53 3360496 3360729 + NZ_CP009467.1 Vibrio harveyi
54 674560 674832 - NZ_CP070624.1 Photobacterium damselae subsp. damselae
55 624382 624636 - NZ_AP018685.1 Vibrio rumoiensis
56 694721 694996 - NZ_CP005974.1 Photobacterium gaetbulicola Gung47
57 2648697 2648936 + NZ_AP019651.1 Vibrio taketomensis
58 450742 451020 - NZ_CP046268.1 Vibrio spartinae
59 1583007 1583279 + NZ_CP072133.1 Pseudoalteromonas xiamenensis
60 3068680 3068958 + NZ_AP014635.1 Vibrio tritonius
61 1161127 1161396 - NC_016043.1 Taylorella asinigenitalis MCE3
62 2510640 2510918 + NZ_CP033078.1 Vibrio zhugei
63 3972164 3972433 + NZ_CP013119.1 Alcaligenes faecalis
64 414989 415228 - NZ_CP032093.1 Vibrio alfacsensis
65 3142602 3142880 - NZ_CP014035.2 Vibrio fluvialis
66 3808909 3809178 - NZ_CP016172.1 Bordetella flabilis
67 966521 966793 - NC_016041.1 Glaciecola nitratireducens FR1064
68 6056749 6056979 - NZ_CP043046.1 Pigmentiphaga aceris
69 9835 10113 - NZ_AP019657.1 Vibrio ponticus
70 2701694 2701948 - NZ_CP025792.1 Vibrio jasicida 090810c
71 1575548 1575826 + NZ_CP020465.1 Cognaticolwellia beringensis
72 417230 417502 - NZ_CP011041.1 Pseudoalteromonas tetraodonis
73 460458 460730 - NZ_CP011030.1 Pseudoalteromonas issachenkonii
74 3034710 3034961 + NZ_CP051180.1 Ferrimonas lipolytica
75 2418566 2418844 + NZ_CP022741.1 Vibrio qinghaiensis
76 2869144 2869416 + NZ_CP011039.1 Pseudoalteromonas spongiae UST010723-006
77 709448 709720 - NZ_CP046670.1 Alteromonas mediterranea
78 108911 109186 - NZ_CP009977.1 Vibrio natriegens NBRC 15636 = ATCC 14048 = DSM 759
79 388038 388313 - NZ_CP047475.1 Vibrio astriarenae
80 1259814 1260083 - NC_018518.1 Bordetella pertussis 18323
81 1958749 1959018 + NZ_LR134326.1 Bordetella bronchiseptica
82 929471 929755 - NZ_CP043043.1 Gluconobacter thailandicus
83 328648 328923 - NZ_CP013187.1 Pseudoalteromonas phenolica
84 1414099 1414368 + NZ_AP019378.1 Bordetella parapertussis
85 4243253 4243522 - NZ_CP038034.1 Achromobacter insolitus
86 518629 518901 - NZ_CP032090.1 Pseudoalteromonas donghaensis
87 1284628 1284900 + NZ_CP019628.1 Pseudoalteromonas aliena
88 2652691 2652969 + NZ_CP016414.1 Vibrio scophthalmi
89 538577 538846 + NZ_CP053986.1 Achromobacter denitrificans
90 1789382 1789633 - NZ_CP072425.1 Pseudoalteromonas viridis
91 2799622 2799891 - NZ_CP016440.1 Bordetella pseudohinzii
92 2115180 2115410 - NZ_CP043146.1 Bordetella holmesii
93 2931303 2931575 + NZ_CP031961.1 Pseudoalteromonas tunicata
94 2204453 2204728 - NZ_CP021377.1 Oceanisphaera profunda
95 2973847 2974116 - NC_010170.1 Bordetella petrii
96 535843 536079 - NZ_AP014690.1 Asaia bogorensis NBRC 16594
97 974149 974439 - NZ_CP068419.1 Gluconobacter sphaericus
98 678209 678439 - NZ_CP011025.1 Pseudoalteromonas arctica A 37-1-2
99 596823 597095 - NZ_CP027523.1 Pseudoalteromonas carrageenovora
100 2630676 2630951 - NZ_CP021376.1 Oceanisphaera avium
101 3520176 3520454 + NZ_CP031416.1 Gallaecimonas mangrovi
102 2770514 2770783 - NZ_LT907988.1 Orrella dioscoreae
++ More..
Neighborhood Conservation Analysis
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Conservation Analysis
Neighborhood Representative Chosen(Species): NC_014012.1
Sr.No. Domain Co-occurrence Frequency No. of species in which domain occurs with smORF Median distance b/w smORF and domain bearing ORFs Orientation relative to smORF PFAM Information
1 PF03448.19 0.76 78 149.5 same-strand MgtE intracellular N domain
2 PF01769.18 0.77 79 150 same-strand Divalent cation transporter
3 PF00571.30 0.69 70 149.5 same-strand CBS domain
4 PF03668.17 0.86 88 7.0 same-strand P-loop ATPase protein family
5 PF00359.24 0.8 82 881.0 same-strand Phosphoenolpyruvate-dependent sugar phosphotransferase system, EIIA 2
6 PF02482.21 0.83 85 1332 same-strand Sigma 54 modulation protein / S30EA ribosomal protein
7 PF04552.15 0.84 86 1648.5 same-strand Sigma-54, DNA binding domain
8 PF04963.15 0.83 85 1649 same-strand Sigma-54 factor, core binding domain
9 PF00309.22 0.83 85 1652 same-strand Sigma-54 factor, Activator interacting domain (AID)
10 PF00005.29 0.83 85 3222.5 same-strand ABC transporter
11 PF12399.10 0.82 84 3206.5 same-strand Branched-chain amino acid ATP-binding cassette transporter
++ More..