Result : Q9RY64
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 50S ribosomal protein L21 |
| NCBI Accession ID | |
| Organism | Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | |
| Sequence | MFAIIQTGGKQYRVSEGDVIRVESLQGEAGDKVELKALFVGGEQTVFGEDAGKYTVQAEVVEHGRGKKIYIRKYKSGVQYRRRTGHRQNFTAIKILGIQG |
| Source of smORF | Swiss-Prot |
| Function | Binds directly to 23S rRNA, probably serving to organize its structure. |
| Pubmed ID | 10567266 11733066 11677599 12535524 12623020 12665853 15059283 15554968 |
| Domain | CDD:412347 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | Q9RY64 |
| ORF Length (Amino Acid) | 100 |
++ More..
| Conservation Analysis |
No. of Species: 50
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1933905 | 1934207 | - | NZ_CP031500.1 | Deinococcus radiodurans |
| 2 | 3112958 | 3113260 | + | NC_017790.1 | Deinococcus gobiensis I-0 |
| 3 | 1460248 | 1460550 | + | NZ_CP011389.1 | Deinococcus soli (ex Cha et al. 2016) |
| 4 | 341369 | 341671 | - | NZ_CP013910.1 | Deinococcus actinosclerus |
| 5 | 374941 | 375243 | - | NZ_CP021081.1 | Deinococcus ficus |
| 6 | 2857034 | 2857336 | - | NZ_CP029494.1 | Deinococcus irradiatisoli |
| 7 | 492700 | 493002 | + | NC_015161.1 | Deinococcus proteolyticus MRP |
| 8 | 3301336 | 3301638 | + | NC_014958.1 | Deinococcus maricopensis DSM 21211 |
| 9 | 2671514 | 2671816 | + | NC_012526.1 | Deinococcus deserti VCD115 |
| 10 | 2815400 | 2815702 | + | NZ_CP010028.1 | Deinococcus radiopugnans |
| 11 | 505608 | 505910 | + | NZ_CP011387.1 | Deinococcus puniceus |
| 12 | 1436944 | 1437243 | + | NC_019793.1 | Deinococcus peraridilitoris DSM 19664 |
| 13 | 2336208 | 2336507 | + | NC_008025.1 | Deinococcus geothermalis DSM 11300 |
| 14 | 1351959 | 1352264 | + | NZ_CP038157.1 | Corynebacterium sanguinis |
| 15 | 24921 | 25226 | + | NC_014221.1 | Truepera radiovictrix DSM 17093 |
| 16 | 1984604 | 1984909 | - | NZ_CP019688.1 | Corynebacterium glaucum |
| 17 | 2030555 | 2030860 | - | NZ_LT906467.1 | Corynebacterium imitans |
| 18 | 1779817 | 1780122 | - | NZ_CP026948.1 | Corynebacterium liangguodongii |
| 19 | 1750252 | 1750557 | - | NZ_CP009215.1 | Corynebacterium ureicelerivorans |
| 20 | 1668295 | 1668600 | - | NC_006461.1 | Thermus thermophilus HB8 |
| 21 | 174867 | 175172 | + | NZ_CP010822.1 | Thermus aquaticus Y51MC23 |
| 22 | 1214249 | 1214554 | + | NZ_CP016312.1 | Thermus brockianus |
| 23 | 327207 | 327512 | + | NZ_CP014141.1 | Thermus parvatiensis |
| 24 | 4184674 | 4184982 | - | NZ_CP042430.1 | Baekduia soli |
| 25 | 2092376 | 2092681 | + | NZ_CP038452.1 | Thermus caldilimi |
| 26 | 251560 | 251850 | + | NZ_CP027226.1 | Fastidiosipila sanguinis |
| 27 | 389942 | 390250 | - | NZ_CP012159.1 | Chondromyces crocatus |
| 28 | 257030 | 257338 | + | NC_015387.1 | Marinithermus hydrothermalis DSM 14884 |
| 29 | 3410976 | 3411275 | - | NZ_AP017655.1 | Sphingobium cloacae |
| 30 | 2047285 | 2047599 | - | NZ_AP022871.1 | Phytohabitans suffuscus |
| 31 | 739410 | 739715 | + | NC_014212.1 | Meiothermus silvanus DSM 9946 |
| 32 | 1615750 | 1616061 | - | NC_009719.1 | Parvibaculum lavamentivorans DS-1 |
| 33 | 239491 | 239796 | + | NC_019386.1 | Thermus oshimai JL-2 |
| 34 | 606909 | 607223 | + | NZ_AP017372.2 | Halorhodospira halochloris |
| 35 | 960947 | 961261 | + | NC_008340.1 | Alkalilimnicola ehrlichii MLHE-1 |
| 36 | 10439314 | 10439622 | + | NZ_CP016211.1 | Minicystis rosea |
| 37 | 662300 | 662611 | + | NZ_CP011367.1 | Thioalkalivibrio versutus |
| 38 | 2469280 | 2469588 | - | NZ_CP018799.1 | Mariprofundus aestuarium |
| 39 | 451724 | 452077 | + | NZ_CP053015.1 | Sphingomonas lacunae |
| 40 | 1173428 | 1173736 | + | NZ_CP041636.1 | Ferrovibrio terrae |
| 41 | 102882 | 103178 | - | NZ_CP060035.1 | Sphingobium fuliginis |
| 42 | 2727408 | 2727704 | + | NC_014006.1 | Sphingobium japonicum UT26S |
| 43 | 2103986 | 2104294 | - | NZ_AP021853.1 | Sporolactobacillus terrae |
| 44 | 2520575 | 2520871 | - | NZ_CP020538.1 | Sphingobium herbicidovorans |
| 45 | 2230652 | 2230960 | - | NZ_CP018800.1 | Mariprofundus ferrinatatus |
| 46 | 774556 | 774867 | + | NZ_CP012621.1 | Zobellella denitrificans |
| 47 | 1213202 | 1213513 | + | NC_014972.1 | Desulfobulbus propionicus DSM 2032 |
| 48 | 1163636 | 1163947 | + | NC_014410.1 | Thermoanaerobacterium thermosaccharolyticum DSM 571 |
| 49 | 267936 | 268250 | + | NC_013939.1 | Deferribacter desulfuricans SSM1 |
| 50 | 2199143 | 2199454 | + | NC_016629.1 | Desulfocurvibacter africanus subsp. africanus str. Walvis Bay |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP031500.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01018.24 | 0.86 | 43 | 429 | same-strand | GTP1/OBG |
| 2 | PF01926.25 | 0.88 | 44 | 441.0 | same-strand | 50S ribosome-binding GTPase |
| 3 | PF09269.13 | 0.6 | 30 | 441.0 | same-strand | Domain of unknown function (DUF1967) |
| 4 | PF02421.20 | 0.7 | 35 | 432.0 | same-strand | Ferrous iron transport protein B |
| 5 | PF01016.21 | 1.0 | 50 | 18.5 | same-strand | Ribosomal L27 protein |
++ More..