Result : Q9RWB8
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Cell division topological specificity factor |
| NCBI Accession ID | AE000513.1 |
| Organism | Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) |
| Left | 768422 |
| Right | 768709 |
| Strand | - |
| Nucleotide Sequence | ATGTTCGGTTGGTTCAAGGGACGCCGCTCCAAGGAAACGCTCAAGGACCGCCTCGAACTGGTGCTCGCCTATGACCGCGCCAAGATCGCGCCCGGCAAGGTCGAGGCCCTGCGCAACGACCTGCTGGAAGTCGTCCAAAAGTACTTCCCCTCGGGCAACTCCAAGGTCGAGGTCGAGCAGGACGGTGACAAGGTGGTCTTGATGGCGAGTATCTCCATCGAAGAGGCTTCGCTCAGCACCGAAGAAGAGAGCGCCGCCGAGGACAAGTCGGACAAACCGAGCGCCTGA |
| Sequence | MFGWFKGRRSKETLKDRLELVLAYDRAKIAPGKVEALRNDLLEVVQKYFPSGNSKVEVEQDGDKVVLMASISIEEASLSTEEESAAEDKSDKPSA |
| Source of smORF | Swiss-Prot |
| Function | Prevents the cell division inhibition by proteins MinC and MinD at internal division sites while permitting inhibition at polar sites. This ensures cell division at the proper site by restricting the formation of a division septum at the midpoint of the long axis of the cell (By similarity). {ECO:0000250}. |
| Pubmed ID | 10567266 |
| Domain | CDD:412433 |
| Functional Category | Others |
| Uniprot ID | Q9RWB8 |
| ORF Length (Amino Acid) | 95 |
++ More..
| Conservation Analysis |
No. of Species: 6
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2613349 | 2613636 | - | NZ_CP031500.1 | Deinococcus radiodurans |
| 2 | 382375 | 382632 | + | NC_008025.1 | Deinococcus geothermalis DSM 11300 |
| 3 | 3060771 | 3061022 | - | NZ_CP010028.1 | Deinococcus radiopugnans |
| 4 | 2549328 | 2549579 | - | NC_012526.1 | Deinococcus deserti VCD115 |
| 5 | 2034338 | 2034598 | + | NC_015161.1 | Deinococcus proteolyticus MRP |
| 6 | 550236 | 550475 | - | NC_019793.1 | Deinococcus peraridilitoris DSM 19664 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP031500.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01656.25 | 1.0 | 6 | 2.0 | same-strand | CobQ/CobB/MinD/ParA nucleotide binding domain |
| 2 | PF13614.8 | 1.0 | 6 | 2.0 | same-strand | AAA domain |
| 3 | PF10609.11 | 0.67 | 4 | 1.0 | same-strand | NUBPL iron-transfer P-loop NTPase |
++ More..