Result : Q9RSH4
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Putative membrane protein insertion efficiency factor |
| NCBI Accession ID | AE000513.1 |
| Organism | Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) |
| Left | 2152118 |
| Right | 2152408 |
| Strand | - |
| Nucleotide Sequence | ATGAGCGCGGCGCCGCTGGTGCGGGCGGTGCGCTGGTATCAGCGCGTCCTTTCGCCGCGCAAGCCCGCGCCGACCTGCCGGTTTAGCCCGACGTGTTCGGAGTACGCTGCTCAGGCACTCGACCGACATGGTGCGCTCAAGGGCGGCTGGCTCGCCCTGTGGCGCGTCCTGCGCTGCAACCCGCTGGTGCCGGGCGGCTTTGATCCGGTGCCCGAGCACTTTCCCGCCCGTCACCCGCGCCCCCAGGGCTCCCCCCCTACGGACCACCCCCCAACGGACCAACCTTCATGA |
| Sequence | MSAAPLVRAVRWYQRVLSPRKPAPTCRFSPTCSEYAAQALDRHGALKGGWLALWRVLRCNPLVPGGFDPVPEHFPARHPRPQGSPPTDHPPTDQPS |
| Source of smORF | Swiss-Prot |
| Function | Could be involved in insertion of integral membrane proteins into the membrane. {ECO:0000255|HAMAP-Rule:MF_00386}. |
| Pubmed ID | 10567266 |
| Domain | CDD:412414 |
| Functional Category | Others |
| Uniprot ID | Q9RSH4 |
| ORF Length (Amino Acid) | 96 |
++ More..
| Conservation Analysis |
No. of Species: 43
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1350095 | 1350385 | - | NZ_CP031500.1 | Deinococcus radiodurans |
| 2 | 2424957 | 2425211 | - | NZ_CP021081.1 | Deinococcus ficus |
| 3 | 1667410 | 1667691 | - | NC_008025.1 | Deinococcus geothermalis DSM 11300 |
| 4 | 1349919 | 1350158 | + | NC_017790.1 | Deinococcus gobiensis I-0 |
| 5 | 814827 | 815111 | + | NZ_CP011387.1 | Deinococcus puniceus |
| 6 | 3008160 | 3008405 | - | NZ_CP025286.1 | Ethanoligenens harbinense YUAN-3 |
| 7 | 1298490 | 1298786 | + | NC_017095.1 | Fervidobacterium pennivorans DSM 9078 |
| 8 | 1579380 | 1579637 | + | NC_016629.1 | Desulfocurvibacter africanus subsp. africanus str. Walvis Bay |
| 9 | 1709763 | 1709999 | - | NZ_CP039543.1 | Desulfovibrio marinus |
| 10 | 80297 | 80536 | - | NZ_LT906467.1 | Corynebacterium imitans |
| 11 | 566159 | 566425 | + | NC_010556.1 | Exiguobacterium sibiricum 255-15 |
| 12 | 3622909 | 3623190 | - | NC_016803.1 | Pseudodesulfovibrio mercurii |
| 13 | 674828 | 675079 | - | NZ_CP053988.1 | Abiotrophia defectiva |
| 14 | 8772250 | 8772507 | - | NC_017093.1 | Actinoplanes missouriensis 431 |
| 15 | 5321342 | 5321623 | - | NC_013757.1 | Geodermatophilus obscurus DSM 43160 |
| 16 | 8285757 | 8286014 | - | NZ_CP023865.1 | Actinoplanes teichomyceticus ATCC 31121 |
| 17 | 1165 | 1398 | + | NZ_CP045529.1 | Luteimicrobium xylanilyticum |
| 18 | 1649313 | 1649582 | - | NZ_CP035492.1 | Paenibacillus protaetiae |
| 19 | 2686534 | 2686815 | + | NZ_LR134477.1 | Actinomyces viscosus |
| 20 | 4378575 | 4378817 | - | NC_014158.1 | Tsukamurella paurometabola DSM 20162 |
| 21 | 6513829 | 6514062 | + | NZ_CP015163.1 | Amycolatopsis albispora |
| 22 | 4660480 | 4660722 | - | NZ_CP015163.1 | Amycolatopsis albispora |
| 23 | 4278334 | 4278588 | - | NC_014541.1 | Ferrimonas balearica DSM 9799 |
| 24 | 907478 | 907720 | + | NZ_CP022680.1 | Streptococcus respiraculi |
| 25 | 1661309 | 1661557 | + | NZ_CP066049.1 | Actinomyces naeslundii |
| 26 | 1327810 | 1328052 | - | NZ_CP032627.1 | Lactococcus allomyrinae |
| 27 | 6850561 | 6850809 | - | NZ_CP016353.1 | Prauserella marina |
| 28 | 10245323 | 10245565 | - | NC_022116.1 | Amycolatopsis mediterranei RB |
| 29 | 3007833 | 3008096 | + | NZ_CP054494.1 | Flavobacterium columnare |
| 30 | 3306726 | 3306965 | - | NC_015588.1 | Isoptericola variabilis 225 |
| 31 | 1182643 | 1182879 | + | NC_017310.1 | Desulfovibrio vulgaris RCH1 |
| 32 | 827489 | 827740 | - | NZ_CP042430.1 | Baekduia soli |
| 33 | 2866 | 3114 | + | NZ_CP016174.1 | Amycolatopsis orientalis |
| 34 | 8947129 | 8947377 | - | NC_021252.1 | Amycolatopsis keratiniphila |
| 35 | 8959856 | 8960104 | - | NZ_CP008953.1 | Amycolatopsis japonica |
| 36 | 2005564 | 2005854 | + | NZ_LR134350.1 | Actinomyces howellii |
| 37 | 959186 | 959500 | - | NC_018691.1 | Alcanivorax dieselolei B5 |
| 38 | 1236524 | 1236760 | - | NZ_CP059276.1 | Lactobacillus taiwanensis |
| 39 | 1306509 | 1306742 | - | NC_020541.1 | Rhodanobacter denitrificans |
| 40 | 3778308 | 3778544 | - | NZ_CP007031.1 | Marichromatium purpuratum 984 |
| 41 | 2418571 | 2418819 | - | NZ_CP053642.1 | Actinomyces marmotae |
| 42 | 626243 | 626518 | + | NZ_AP019750.1 | Lactobacillus delbrueckii subsp. delbrueckii |
| 43 | 1300811 | 1301056 | - | NZ_CP030356.1 | Salinibacter ruber |
| 44 | 2767648 | 2767896 | + | NZ_CP066060.1 | Actinomyces oris |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP031500.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02096.22 | 0.74 | 32 | 5.0 | same-strand | 60Kd inner membrane protein |
++ More..