Result : Q9RN26
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein pXO2-06/BXB0005/GBAA_pXO2_0005 |
| NCBI Accession ID | AF188935.1 |
| Organism | Bacillus anthracis |
| Left | 3085 |
| Right | 3360 |
| Strand | - |
| Nucleotide Sequence | ATGCTTTTGAGTGAACTAAAACCCAATCATGATTATGCAAAAGAAGGGAAGTATTTAATTTTAAGTCTTCGGAAAAAGAAGGGGGTTCGAAAAGATAAGTTCATTGAAATACCGATTACATGGTTTGATTATAACTTTGGAGAAAAAGTGGAATGGCTCATTGTACGAGAATATCAGCCAAGTGTTAACGGGAAAGAAAAGTATACAAACTGTAAACTGGAAAACATTCACGCACAAGTGAGTGTAGTAAATGTGAAAGGAGAAAGAATGAAATGA |
| Sequence | MLLSELKPNHDYAKEGKYLILSLRKKKGVRKDKFIEIPITWFDYNFGEKVEWLIVREYQPSVNGKEKYTNCKLENIHAQVSVVNVKGERMK |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of pfam17632. Profile Description: Family of unknown function (DUF5513). This is a family of unknown function found in Bacillus. |
| Pubmed ID | 10475962 12004073 18952800 |
| Domain | CDD:340347 |
| Functional Category | Others |
| Uniprot ID | Q9RN26 |
| ORF Length (Amino Acid) | 91 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2591 | 2866 | - | NC_007323.3 | Bacillus anthracis str. 'Ames Ancestor' |
| 2 | 74288 | 74566 | + | NZ_CP024110.1 | Bacillus cytotoxicus |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_007323.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF13702.8 | 1.0 | 2 | 732.0 | same-strand | Lysozyme-like |
| 2 | PF00877.21 | 1.0 | 2 | 732.0 | same-strand | NlpC/P60 family |
| 3 | PF17332.4 | 1.0 | 2 | 4549.0 | same-strand | Family of unknown function (DUF5592) |
++ More..