Protein Information |
Information Type | Description |
---|---|
Protein name | Uncharacterized protein pXO2-06/BXB0005/GBAA_pXO2_0005 |
NCBI Accession ID | AF188935.1 |
Organism | Bacillus anthracis |
Left | 3085 |
Right | 3360 |
Strand | - |
Nucleotide Sequence | ATGCTTTTGAGTGAACTAAAACCCAATCATGATTATGCAAAAGAAGGGAAGTATTTAATTTTAAGTCTTCGGAAAAAGAAGGGGGTTCGAAAAGATAAGTTCATTGAAATACCGATTACATGGTTTGATTATAACTTTGGAGAAAAAGTGGAATGGCTCATTGTACGAGAATATCAGCCAAGTGTTAACGGGAAAGAAAAGTATACAAACTGTAAACTGGAAAACATTCACGCACAAGTGAGTGTAGTAAATGTGAAAGGAGAAAGAATGAAATGA |
Sequence | MLLSELKPNHDYAKEGKYLILSLRKKKGVRKDKFIEIPITWFDYNFGEKVEWLIVREYQPSVNGKEKYTNCKLENIHAQVSVVNVKGERMK |
Source of smORF | Swiss-Prot |
Function | The ORF matches to the profile of pfam17632. Profile Description: Family of unknown function (DUF5513). This is a family of unknown function found in Bacillus. |
Pubmed ID | 10475962 12004073 18952800 |
Domain | CDD:340347 |
Functional Category | Others |
Uniprot ID | Q9RN26 |
ORF Length (Amino Acid) | 91 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 2591 | 2866 | - | NC_007323.3 | Bacillus anthracis str. 'Ames Ancestor' |
2 | 74288 | 74566 | + | NZ_CP024110.1 | Bacillus cytotoxicus |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF13702.8 | 1.0 | 2 | 732.0 | same-strand | Lysozyme-like |
2 | PF00877.21 | 1.0 | 2 | 732.0 | same-strand | NlpC/P60 family |
3 | PF17332.4 | 1.0 | 2 | 4549.0 | same-strand | Family of unknown function (DUF5592) |