Result : Q9RN19
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein pXO2-13/BXB0012/GBAA_pXO2_0012 |
| NCBI Accession ID | AF188935.1 |
| Organism | Bacillus anthracis |
| Left | 8432 |
| Right | 8686 |
| Strand | - |
| Nucleotide Sequence | ATGAAAGTAATTGATATTGCGAATCGAAGAAGAATTTACTTTGAAATGAAGCAACAAGAATTACGAGCTAGTATCCTAATGACGGTAGCAGGATTCATTATTGCCTTTGCTATACTGGTTTTTCAAATAAGTTTTGAGTTAGGTCACTTATATCATTACATTGTTACTTTTGCCTTTCTAACTTATCTTTCTCTCCATCTGTACTCGAACAATAAGTTAGCAAGAAAAATAGAGAAGAAGCAGCAGGGATATTAA |
| Sequence | MKVIDIANRRRIYFEMKQQELRASILMTVAGFIIAFAILVFQISFELGHLYHYIVTFAFLTYLSLHLYSNNKLARKIEKKQQGY |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 10475962 12004073 18952800 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | Q9RN19 |
| ORF Length (Amino Acid) | 84 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 7938 | 8192 | - | NC_007323.3 | Bacillus anthracis str. 'Ames Ancestor' |
| 2 | 68166 | 68426 | + | NZ_CP024110.1 | Bacillus cytotoxicus |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_007323.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF17332.4 | 1.0 | 2 | 604.0 | same-strand | Family of unknown function (DUF5592) |
| 2 | PF12696.9 | 1.0 | 2 | 2943.0 | same-strand | TraM recognition site of TraD and TraG |
| 3 | PF04956.15 | 1.0 | 2 | 7642.5 | same-strand | TrbC/VIRB2 pilin |
| 4 | PF18895.2 | 1.0 | 2 | 7642.5 | same-strand | Type IV secretion system pilin |
++ More..