ProsmORF-pred
Result : A9WJV5
Protein Information
Information Type Description
Protein name CRISPR-associated endoribonuclease Cas2 3 (EC 3.1.-.-)
NCBI Accession ID CP000909.1
Organism Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl)
Left 4531267
Right 4531548
Strand +
Nucleotide Sequence ATGAAAATGTTCACAGTTATCAGTTATGATATCGTCGATGATCAGCGTCGCACCAGCGTGATGAAGGTGCTGAAAGGATACGGTGTGCGCGTTCAGTACAGCGTCTTCGAAGCCATTCTCGACGCACGCGAGTTTCACGACCTGAGCAACCAGCTTCGCAAGATTATTGATCCAGGCCAGGATAGTATACGCTGCTATCGTCTGGACCAGGTAGCTGCTCAACGCACGGTCATCTACGGTATTGGCCTTACCACAACCGATCCGACACATTACATGGTATAG
Sequence MKMFTVISYDIVDDQRRTSVMKVLKGYGVRVQYSVFEAILDAREFHDLSNQLRKIIDPGQDSIRCYRLDQVAAQRTVIYGIGLTTTDPTHYMV
Source of smORF Swiss-Prot
Function CRISPR (clustered regularly interspaced short palindromic repeat), is an adaptive immune system that provides protection against mobile genetic elements (viruses, transposable elements and conjugative plasmids). CRISPR clusters contain sequences complementary to antecedent mobile elements and target invading nucleic acids. CRISPR clusters are transcribed and processed into CRISPR RNA (crRNA). Functions as a ssRNA-specific endoribonuclease. Involved in the integration of spacer DNA into the CRISPR cassette. {ECO:0000255|HAMAP-Rule:MF_01471}.
Pubmed ID 21714912
Domain CDD:416272
Functional Category Metal-binding
Uniprot ID A9WJV5
ORF Length (Amino Acid) 93
++ More..