Protein Information |
Information Type | Description |
---|---|
Protein name | Uncharacterized protein pXO2-34/BXB0033/GBAA_pXO2_0033 |
NCBI Accession ID | AF188935.1 |
Organism | Bacillus anthracis |
Left | 28552 |
Right | 28854 |
Strand | - |
Nucleotide Sequence | ATGAGAGAAAAAGAGTTTAGCAAAAGTACACACAGGCTGAAAGTAACCAAAGAAATGGATATTGGCACTCTATTAAACAGAGCGCACAAAGTTAGTACCTTTGATGGCAAGAATTTAATTGTTCTCGATAATGGCAATCTGTACGATCAAGCAGGAAGAAGAGAAGTTCCTGTAACAAATATGTTTAGGTATATCAAAAGCGTAAGAAATAGCGATGGAATTGTTATCGCAAAGAAGAATAAACCATGCGGAAAGTTAATGCAGGTTATTTTTGAGAGAAAAGCAAAGCAAAAAGTAAAATAG |
Sequence | MREKEFSKSTHRLKVTKEMDIGTLLNRAHKVSTFDGKNLIVLDNGNLYDQAGRREVPVTNMFRYIKSVRNSDGIVIAKKNKPCGKLMQVIFERKAKQKVK |
Source of smORF | Swiss-Prot |
Function | The ORF matches to the profile of pfam17362. Profile Description: Family of unknown function. This is a family of unknown function found in Bacilli. |
Pubmed ID | 10475962 12004073 18952800 |
Domain | CDD:375153 |
Functional Category | Others |
Uniprot ID | Q9RMZ8 |
ORF Length (Amino Acid) | 100 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 28062 | 28364 | - | NC_007323.3 | Bacillus anthracis str. 'Ames Ancestor' |
2 | 45790 | 46089 | + | NZ_CP024110.1 | Bacillus cytotoxicus |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF17631.4 | 1.0 | 2 | 1436.5 | same-strand | Family of unknown function (DUF5512) |
2 | PF08708.13 | 1.0 | 2 | 3561.5 | same-strand | Primase C terminal 1 (PriCT-1) |