Result : Q9RMZ8

Protein Information

• Protein name: Uncharacterized protein pXO2-34/BXB0033/GBAA_pXO2_0033
• NCBI Accession ID: AF188935.1
• Organism: Bacillus anthracis
• Left: 28552
• Right: 28854
• Strand: -
• Nucleotide Sequence: ATGAGAGAAAAAGAGTTTAGCAAAAGTACACACAGGCTGAAAGTAACCAAAGAAATGGATATTGGCACTCTATTAAACAGAGCGCACAAAGTTAGTACCTTTGATGGCAAGAATTTAATTGTTCTCGATAATGGCAATCTGTACGATCAAGCAGGAAGAAGAGAAGTTCCTGTAACAAATATGTTTAGGTATATCAAAAGCGTAAGAAATAGCGATGGAATTGTTATCGCAAAGAAGAATAAACCATGCGGAAAGTTAATGCAGGTTATTTTTGAGAGAAAAGCAAAGCAAAAAGTAAAATAG
• Sequence: MREKEFSKSTHRLKVTKEMDIGTLLNRAHKVSTFDGKNLIVLDNGNLYDQAGRREVPVTNMFRYIKSVRNSDGIVIAKKNKPCGKLMQVIFERKAKQKVK
• Source of smORF: Swiss-Prot
• Function: The ORF matches to the profile of pfam17362. Profile Description: Family of unknown function. This is a family of unknown function found in Bacilli.
• Pubmed ID: 10475962 12004073 18952800
• Domain: CDD:375153
• Functional Category: Others
• Uniprot ID: Q9RMZ8
• ORF Length (Amino Acid): 100

Conservation Analysis

No. of Species: 2

Sr.No.	Left Position	Right Position	Strand	NCBI Accession id	Species Name
1	28062	28364	-	NC_007323.3	Bacillus anthracis str. 'Ames Ancestor'
2	45790	46089	+	NZ_CP024110.1	Bacillus cytotoxicus

Neighborhood Conservation Analysis

^* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
^* 'Small ORF' represents the entry/query analyzed.
^* Image generated using 'gggenes'(R-Package).

Neighborhood Representative Chosen(Species): NC_007323.3

Sr.No.	Domain	Co-occurrence Frequency	No. of species in which domain occurs with smORF	Median distance b/w smORF and domain bearing ORFs	Orientation relative to smORF	PFAM Information
1	PF17631.4	1.0	2	1436.5	same-strand	Family of unknown function (DUF5512)
2	PF08708.13	1.0	2	3561.5	same-strand	Primase C terminal 1 (PriCT-1)