Result : Q9RMX8
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein pXO2-54/BXB0062/GBAA_pXO2_0062 |
| NCBI Accession ID | AF188935.1 |
| Organism | Bacillus anthracis |
| Left | 52637 |
| Right | 52780 |
| Strand | - |
| Nucleotide Sequence | ATGGTTAAAAAAGTTTTTGGATGGATTATGCCGATTTTAATTGTAGGTTTATTACTTGTAACAATGGGGACCTTTAAACGTTCGGAAACATTAACGACTGATGAGCAGAAGAAGATTAGTGATTATCTACAGGCTAACCCCTAA |
| Sequence | MVKKVFGWIMPILIVGLLLVTMGTFKRSETLTTDEQKKISDYLQANP |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 10475962 12004073 18952800 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | Q9RMX8 |
| ORF Length (Amino Acid) | 47 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 52147 | 52290 | - | NC_007323.3 | Bacillus anthracis str. 'Ames Ancestor' |
| 2 | 1219758 | 1219907 | + | NZ_CP030926.1 | Peribacillus butanolivorans |
| 3 | 3937317 | 3937466 | - | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP030926.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01019.23 | 1.0 | 3 | 71 | same-strand | Gamma-glutamyltranspeptidase |
| 2 | PF09587.12 | 1.0 | 3 | 1727 | same-strand | Bacterial capsule synthesis protein PGA cap |
| 3 | PF14102.8 | 1.0 | 3 | 3021 | same-strand | Capsule biosynthesis CapC |
| 4 | PF08245.14 | 1.0 | 3 | 3486 | same-strand | Mur ligase middle domain |
| 5 | PF05908.13 | 0.67 | 2 | 83.0 | same-strand | Poly-gamma-glutamate hydrolase |
| 6 | PF00877.21 | 0.67 | 2 | 759.5 | opposite-strand | NlpC/P60 family |
| 7 | PF01476.22 | 0.67 | 2 | 759.5 | opposite-strand | LysM domain |
++ More..