Protein Information |
Information Type | Description |
---|---|
Protein name | Uncharacterized protein pXO2-82/BXB0112/GBAA_pXO2_0112 |
NCBI Accession ID | AF188935.1 |
Organism | Bacillus anthracis |
Left | 93568 |
Right | 93777 |
Strand | - |
Nucleotide Sequence | ATGTCTCAAAATAATTTTTATATGGTTGAACATGTAGACCAAGTAAAGAATGAGGTTCATCTAAGTAAATACTTATTCAATAAACAAGTTATCGTAAAAGTTTCAGAAAAAGAAGCGGCAGCCTATGCCGAGTTCATGAACGGGGCAGTGGAACACGATAGTATACCATTTGTAAAATATGATGAAGAAAGAGGGTTAATTTGCGAATGA |
Sequence | MSQNNFYMVEHVDQVKNEVHLSKYLFNKQVIVKVSEKEAAAYAEFMNGAVEHDSIPFVKYDEERGLICE |
Source of smORF | Swiss-Prot |
Function | The ORF matches to the profile of pfam17630. Profile Description: Family of unknown function (DUF5511). This is a family of unknown function found in Bacillus. |
Pubmed ID | 10475962 12004073 18952800 |
Domain | CDD:340345 |
Functional Category | Others |
Uniprot ID | Q9RMV3 |
ORF Length (Amino Acid) | 69 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 93094 | 93303 | - | NC_007323.3 | Bacillus anthracis str. 'Ames Ancestor' |
2 | 79192 | 79401 | + | NZ_CP024110.1 | Bacillus cytotoxicus |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF17633.4 | 1.0 | 2 | 23.0 | same-strand | Family of unknown function (DUF5514) |