Result : Q9RHM8
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 2-hydroxymuconate tautomerase (EC 5.3.2.6) (4-oxalocrotonate tautomerase) (4-OT) |
| NCBI Accession ID | AB029044.1 |
| Organism | Comamonas testosteroni (Pseudomonas testosteroni) |
| Left | 10151 |
| Right | 10342 |
| Strand | + |
| Nucleotide Sequence | ATGCCATTCGCACAAATCTACATGCTGGAAGGCCGCAGCGAGGAACAGAAAAAGGCGGTGATCGAAAAGGTTACCCGGGCCCTGGTCGAGGCCGTTGGCGCTCCCTCCGCCAATGTGCGGGTCTGGATACACGATGTGCCCAAGGAGAACTGGGGCATTGCCGGCGTCAGTGCCAAAGAACTGGGGCGCTGA |
| Sequence | MPFAQIYMLEGRSEEQKKAVIEKVTRALVEAVGAPSANVRVWIHDVPKENWGIAGVSAKELGR |
| Source of smORF | Swiss-Prot |
| Function | Catalyzes the ketonization of 2-hydroxymuconate stereoselectively to yield 2-oxo-3-hexenedioate. |
| Pubmed ID | 10878134 |
| Domain | CDD:412246 |
| Functional Category | Others |
| Uniprot ID | Q9RHM8 |
| ORF Length (Amino Acid) | 63 |
++ More..
| Conservation Analysis |
No. of Species: 60
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 325148 | 325339 | + | NZ_CP051298.1 | Alicycliphilus denitrificans |
| 2 | 2987838 | 2988029 | - | NZ_CP060790.1 | Acidovorax monticola |
| 3 | 2593054 | 2593245 | + | NZ_CP060714.1 | Diaphorobacter ruginosibacter |
| 4 | 238107 | 238298 | + | NZ_CP021359.1 | Acidovorax carolinensis |
| 5 | 3128613 | 3128804 | - | NC_008786.1 | Verminephrobacter eiseniae EF01-2 |
| 6 | 1804925 | 1805116 | + | NC_016147.2 | Pseudoxanthomonas spadix BD-a59 |
| 7 | 2933141 | 2933332 | + | NZ_CP027669.1 | Simplicispira suum |
| 8 | 2423431 | 2423622 | - | NC_008825.1 | Methylibium petroleiphilum PM1 |
| 9 | 3717442 | 3717633 | - | NC_010524.1 | Leptothrix cholodnii SP-6 |
| 10 | 1445488 | 1445679 | + | NZ_CP022423.1 | Vitreoscilla filiformis |
| 11 | 2762276 | 2762467 | - | NZ_CP016210.1 | Azoarcus olearius |
| 12 | 3944636 | 3944827 | + | NZ_CP017476.1 | Hydrogenophaga crassostreae |
| 13 | 2254389 | 2254580 | + | NZ_CP064338.1 | Schlegelella thermodepolymerans |
| 14 | 263488 | 263679 | - | NZ_CP029641.1 | Paraburkholderia dokdonella |
| 15 | 370745 | 370936 | - | NZ_CP037867.1 | Hydrogenophaga pseudoflava |
| 16 | 933217 | 933408 | - | NZ_HG916765.1 | Castellaniella defragrans 65Phen |
| 17 | 386748 | 386939 | + | NZ_CP014646.1 | Thauera humireducens |
| 18 | 479192 | 479383 | + | NZ_LT906434.1 | Neisseria zoodegmatis |
| 19 | 993644 | 993835 | - | NZ_LR134313.1 | Neisseria canis |
| 20 | 1028154 | 1028345 | - | NZ_CP059565.1 | Neisseria wadsworthii |
| 21 | 732839 | 733030 | + | NZ_CP040449.1 | Aeromonas simiae |
| 22 | 3729246 | 3729437 | - | NZ_CP011835.1 | Azotobacter chroococcum |
| 23 | 3657362 | 3657553 | + | NZ_CP045302.1 | Azotobacter salinestris |
| 24 | 2190822 | 2191013 | - | NZ_CP017755.1 | Cupriavidus malaysiensis |
| 25 | 641999 | 642190 | + | NZ_CP043869.1 | Neptunomonas concharum |
| 26 | 1297561 | 1297752 | + | NZ_CP041070.1 | Arcobacter anaerophilus |
| 27 | 825304 | 825495 | + | NC_012560.1 | Azotobacter vinelandii DJ |
| 28 | 834174 | 834365 | - | NC_012560.1 | Azotobacter vinelandii DJ |
| 29 | 4117236 | 4117427 | + | NZ_CP018845.1 | Herbaspirillum robiniae |
| 30 | 2960329 | 2960520 | - | NZ_CP017715.1 | Marinobacter salinus |
| 31 | 4274326 | 4274517 | + | NC_017506.1 | Marinobacter adhaerens HP15 |
| 32 | 1143908 | 1144099 | + | NC_017506.1 | Marinobacter adhaerens HP15 |
| 33 | 1042867 | 1043058 | + | NZ_CP062804.1 | Cupriavidus basilensis |
| 34 | 2335140 | 2335331 | + | NZ_CP022196.1 | Celeribacter ethanolicus |
| 35 | 999940 | 1000131 | + | NZ_CP030944.1 | Arcobacter aquimarinus |
| 36 | 620403 | 620594 | + | NZ_CP039288.1 | Cupriavidus necator H16 |
| 37 | 996046 | 996237 | + | NZ_AP012273.1 | Thiolapillus brandeum |
| 38 | 2042700 | 2042891 | + | NZ_CP014671.1 | Immundisolibacter cernigliae |
| 39 | 287634 | 287825 | - | NZ_CP054051.1 | Aliarcobacter cibarius |
| 40 | 1736428 | 1736619 | - | NZ_AP014862.1 | Pseudomonas furukawaii |
| 41 | 1689114 | 1689323 | - | NC_013205.1 | Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446 |
| 42 | 973593 | 973811 | + | NC_014098.1 | Kyrpidia tusciae DSM 2912 |
| 43 | 3145933 | 3146124 | - | NZ_CP012621.1 | Zobellella denitrificans |
| 44 | 2843866 | 2844051 | + | NZ_CP038015.1 | Paenisporosarcina antarctica |
| 45 | 2041519 | 2041704 | + | NZ_CP009709.1 | Weizmannia coagulans DSM 1 = ATCC 7050 |
| 46 | 2792102 | 2792287 | + | NZ_CP016537.2 | Planococcus halocryophilus |
| 47 | 2700118 | 2700303 | + | NZ_CP016540.2 | Planococcus versutus |
| 48 | 4693974 | 4694159 | + | NZ_CP042593.1 | Bacillus dafuensis |
| 49 | 3010880 | 3011065 | - | NZ_CP068053.1 | Peribacillus psychrosaccharolyticus |
| 50 | 4237258 | 4237443 | + | NZ_LT603683.1 | Bacillus glycinifermentans |
| 51 | 660038 | 660223 | - | NZ_CP031223.1 | Psychrobacillus glaciei |
| 52 | 2453306 | 2453491 | + | NZ_CP038012.1 | Sporosarcina pasteurii |
| 53 | 2563344 | 2563550 | - | NZ_CP038012.1 | Sporosarcina pasteurii |
| 54 | 3025502 | 3025687 | + | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
| 55 | 3534332 | 3534517 | - | NC_016584.1 | Desulfosporosinus orientis DSM 765 |
| 56 | 3008118 | 3008324 | + | NZ_CP031092.1 | Salicibibacter kimchii |
| 57 | 2612813 | 2613001 | + | NZ_CP061470.1 | Geobacillus zalihae |
| 58 | 366924 | 367112 | - | NZ_CP018058.1 | Geobacillus thermocatenulatus |
| 59 | 3451688 | 3451876 | + | NC_006510.1 | Geobacillus kaustophilus HTA426 |
| 60 | 261979 | 262164 | - | NC_010556.1 | Exiguobacterium sibiricum 255-15 |
| 61 | 1613345 | 1613524 | + | NZ_CP048813.1 | Rhodococcus triatomae |
| 62 | 3411265 | 3411444 | - | NZ_CP022208.1 | Rhodococcus pyridinivorans |
| 63 | 3108758 | 3108937 | - | NZ_LT906450.1 | Rhodococcus rhodochrous |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP051298.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF09290.13 | 0.62 | 37 | 1852.0 | same-strand | Prokaryotic acetaldehyde dehydrogenase, dimerisation |
| 2 | PF01118.26 | 0.62 | 37 | 1852.0 | same-strand | Semialdehyde dehydrogenase, NAD binding domain |
| 3 | PF00682.21 | 0.62 | 37 | 840 | same-strand | HMGL-like |
| 4 | PF07836.13 | 0.62 | 37 | 840 | same-strand | DmpG-like communication domain |
++ More..