Result : Q9RGZ0
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Na(+)/H(+) antiporter subunit F (Mrp complex subunit F) (Multiple resistance and pH homeostasis protein F) |
| NCBI Accession ID | AF097740.3 |
| Organism | Alkalihalobacillus pseudofirmus (strain ATCC BAA-2126 / JCM 17055 / OF4) (Bacillus pseudofirmus) |
| Left | 5969 |
| Right | 6244 |
| Strand | + |
| Nucleotide Sequence | ATGTTCCAATCCATTTTAATGATTGTATTAGTGGTCATGTCTATCTCATTGTTCGTTTGCTTTATCCGTACATTAATCGGCCCTACGATGTCTGACCGCATCGTAGCGCTTGATACATTTGGCATCAATCTAATAGGCTTCATCGGGGTCATTATGATGCTTCAGGAAACTTTGGCATACTCAGAAGTTGTTCTTGTCATTAGTATTCTTGCCTTTATCGGGTCGATTGCGCTTTCTAAATTTATTGAAAGGGGTGTTGTCTTTGACCGCGGTTGA |
| Sequence | MFQSILMIVLVVMSISLFVCFIRTLIGPTMSDRIVALDTFGINLIGFIGVIMMLQETLAYSEVVLVISILAFIGSIALSKFIERGVVFDRG |
| Source of smORF | Swiss-Prot |
| Function | Mnh complex is a Na(+)Li(+)/H(+) antiporter involved in Na(+) and/or Li(+) excretion and Na(+) resistance. Na(+)/H(+) antiport consumes a transmembrane electrical potential, and is thus inferred to be electrogenic. Does not transport K(+), Ca(2+) or Mg(2+). |
| Pubmed ID | 11356194 21951522 17293423 |
| Domain | CDD:415596 |
| Functional Category | Others |
| Uniprot ID | Q9RGZ0 |
| ORF Length (Amino Acid) | 91 |
++ More..
| Conservation Analysis |
No. of Species: 11
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1066422 | 1066697 | - | NC_013791.2 | Alkalihalobacillus pseudofirmus OF4 |
| 2 | 1403046 | 1403333 | - | NC_002570.2 | Alkalihalobacillus halodurans C-125 |
| 3 | 1300886 | 1301167 | - | NZ_CP012502.1 | Bacillus beveridgei |
| 4 | 3741320 | 3741601 | - | NZ_CP035485.1 | Salicibibacter halophilus |
| 5 | 59655 | 59915 | - | NZ_CP035485.1 | Salicibibacter halophilus |
| 6 | 82905 | 83186 | - | NZ_CP031092.1 | Salicibibacter kimchii |
| 7 | 1755016 | 1755297 | - | NC_014829.1 | Evansella cellulosilytica DSM 2522 |
| 8 | 2021640 | 2021918 | + | NC_004193.1 | Oceanobacillus iheyensis HTE831 |
| 9 | 111357 | 111596 | + | NZ_CP063356.1 | Anaerobacillus isosaccharinicus |
| 10 | 4617897 | 4618190 | - | NZ_CP004078.1 | Paenibacillus sabinae T27 |
| 11 | 1432189 | 1432470 | + | NZ_CP029797.1 | Paraliobacillus zengyii |
| 12 | 1720268 | 1720552 | + | NZ_LS483476.1 | Lederbergia lentus |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_013791.2
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF03334.16 | 1.0 | 11 | -19.0 | same-strand | Na+/H+ antiporter subunit |
| 2 | PF01899.18 | 1.0 | 11 | 0.0 | same-strand | Na+/H+ ion antiporter subunit |
| 3 | PF00361.22 | 1.0 | 11 | 874 | same-strand | Proton-conducting membrane transporter |
| 4 | PF00420.26 | 1.0 | 11 | 1960.0 | same-strand | NADH-ubiquinone/plastoquinone oxidoreductase chain 4L |
| 5 | PF04039.15 | 1.0 | 11 | 2297 | same-strand | Domain related to MnhB subunit of Na+/H+ antiporter |
| 6 | PF13244.8 | 1.0 | 11 | 2729 | same-strand | Domain of unknown function (DUF4040) |
| 7 | PF00662.22 | 1.0 | 11 | 2729 | same-strand | NADH-Ubiquinone oxidoreductase (complex I), chain 5 N-terminus |
++ More..