Result : Q9PR89

Protein Information

• Protein name: Probable protein-export membrane protein SecG
• NCBI Accession ID: AF222894.1
• Organism: Ureaplasma parvum serovar 3 (strain ATCC 700970)
• Left: 70018
• Right: 70242
• Strand: +
• Nucleotide Sequence: ATGGCATTAACAATTGTTTTAATCTTGTTTAGTGTTCTAGCTTTAATAATAGGTTTATTATTATCAAGAACTTCACCATCTGGTGGATTGTCAAGTTTAAATGGACAAGATCTAGAAATTTTTAAAAAAACAAAAGACCGTGGTTGAATTAAAGGTTTACAAGTCTTTATGTTTTTATTAACAATTGTTATGATTTTAATAATAATTTTTTATAGAGTGAGCTAG
• Sequence: MALTIVLILFSVLALIIGLLLSRTSPSGGLSSLNGQDLEIFKKTKDRGWIKGLQVFMFLLTIVMILIIIFYRVS
• Source of smORF: Swiss-Prot
• Function: Involved in protein export. Participates in an early event of protein translocation (By similarity). {ECO:0000250}.
• Pubmed ID: 11048724
• Domain: CDD:415590
• Functional Category: Others
• Uniprot ID: Q9PR89
• ORF Length (Amino Acid): 74

Conservation Analysis

No. of Species: 2

Sr.No.	Left Position	Right Position	Strand	NCBI Accession id	Species Name
1	131179	131382	+	NC_000908.2	Mycoplasma genitalium G37
2	292541	292741	+	NZ_CP010546.1	Mycoplasma pneumoniae FH

Neighborhood Conservation Analysis

^* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
^* 'Small ORF' represents the entry/query analyzed.
^* Image generated using 'gggenes'(R-Package).

Neighborhood Representative Chosen(Species): NC_000908.2

Sr.No.	Domain	Co-occurrence Frequency	No. of species in which domain occurs with smORF	Median distance b/w smORF and domain bearing ORFs	Orientation relative to smORF	PFAM Information
1	PF02934.17	1.0	2	2472.5	same-strand	GatB/GatE catalytic domain
2	PF02637.20	1.0	2	2472.5	same-strand	GatB domain
3	PF07992.16	1.0	2	889.5	same-strand	Pyridine nucleotide-disulphide oxidoreductase
4	PF00070.29	1.0	2	889.5	same-strand	Pyridine nucleotide-disulphide oxidoreductase
5	PF14527.8	1.0	2	110.0	same-strand	WhiA LAGLIDADG-like domain
6	PF17876.3	1.0	2	269.5	same-strand	Cold shock domain
7	PF00575.25	1.0	2	1637.5	same-strand	S1 RNA binding domain