Result : A9WFZ7
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | CRISPR-associated endoribonuclease Cas2 2 (EC 3.1.-.-) |
| NCBI Accession ID | CP000909.1 |
| Organism | Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) |
| Left | 3961483 |
| Right | 3961740 |
| Strand | + |
| Nucleotide Sequence | ATGCAATGTCTTGTCATCTACGACATTCCCAATGATCGGGCAAGACAGCGAGTCGCTGATGCCTGCCTCGACTATGGCCTGCAACGAATTCAATATAGTGCTTTCGCCGGGAATCTCAGCCGGACCCATCAACGGGCACTATTCGGCGAAATAACCCGGCGGGTCAAAGGTCATACCGCAAACGTCCAACTTTTCGTCTTCGACAGCAAAACCTGGAGTGATCGGCGCATACTGGAGCAGCAATATGACGATGCCTGA |
| Sequence | MQCLVIYDIPNDRARQRVADACLDYGLQRIQYSAFAGNLSRTHQRALFGEITRRVKGHTANVQLFVFDSKTWSDRRILEQQYDDA |
| Source of smORF | Swiss-Prot |
| Function | CRISPR (clustered regularly interspaced short palindromic repeat), is an adaptive immune system that provides protection against mobile genetic elements (viruses, transposable elements and conjugative plasmids). CRISPR clusters contain sequences complementary to antecedent mobile elements and target invading nucleic acids. CRISPR clusters are transcribed and processed into CRISPR RNA (crRNA). Functions as a ssRNA-specific endoribonuclease. Involved in the integration of spacer DNA into the CRISPR cassette. {ECO:0000255|HAMAP-Rule:MF_01471}. |
| Pubmed ID | 21714912 |
| Domain | CDD:416272 |
| Functional Category | Metal-binding |
| Uniprot ID | A9WFZ7 |
| ORF Length (Amino Acid) | 85 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 701542 | 701799 | - | NC_011831.1 | Chloroflexus aggregans DSM 9485 |
| 2 | 4296101 | 4296358 | + | NC_009767.1 | Roseiflexus castenholzii DSM 13941 |
| 3 | 810403 | 810645 | - | NC_017583.1 | Spirochaeta thermophila DSM 6578 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_011831.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01930.19 | 1.0 | 3 | -7 | same-strand | Domain of unknown function DUF83 |
| 2 | PF01867.18 | 1.0 | 3 | 33 | same-strand | CRISPR associated protein Cas1 |
| 3 | PF10040.11 | 1.0 | 3 | 1689 | same-strand | CRISPR-associated endoribonuclease Cas6 |
| 4 | PF00270.31 | 0.67 | 2 | 2436.0 | same-strand | DEAD/DEAH box helicase |
| 5 | PF18019.3 | 0.67 | 2 | 2436.0 | same-strand | HD domain |
| 6 | PF00271.33 | 0.67 | 2 | 2436.0 | same-strand | Helicase conserved C-terminal domain |
++ More..