Result : Q9PQI1

Protein Information

• Protein name: 30S ribosomal protein S20
• NCBI Accession ID: AF222894.1
• Organism: Ureaplasma parvum serovar 3 (strain ATCC 700970)
• Left: 355093
• Right: 355347
• Strand: -
• Nucleotide Sequence: ATGGCAAATATTGTTTCAAATGAAAAAACATACAGACATACGCAAAAAGTACGTAAGGAAAATCATGCTAAAATGTCTAAATTAAGAACAATTGTTAAAAAAACAAGAAGTTCAAATGAACAAGCTCAACTTAATGAAGCTTACAAAGTCATTGATACAACAGCTTCAAAAGGTGTTATTCACAAAAATAAAGCAAATCGTTTAAAATCAAGAACAGCAAAAGCTTTTAAAACAAACTTAGAAGTCACAGCATAA
• Sequence: MANIVSNEKTYRHTQKVRKENHAKMSKLRTIVKKTRSSNEQAQLNEAYKVIDTTASKGVIHKNKANRLKSRTAKAFKTNLEVTA
• Source of smORF: Swiss-Prot
• Function: Binds directly to 16S ribosomal RNA. {ECO:0000255|HAMAP-Rule:MF_00500}.
• Pubmed ID: 11048724
• Domain: CDD:412349
• Functional Category: Ribosomal_protein
• Uniprot ID: Q9PQI1
• ORF Length (Amino Acid): 84

Conservation Analysis

No. of Species: 2

Sr.No.	Left Position	Right Position	Strand	NCBI Accession id	Species Name
1	355132	355386	-	NC_010503.1	Ureaplasma parvum serovar 3 str. ATCC 27815
2	353172	353426	-	NC_011374.1	Ureaplasma urealyticum serovar 10 str. ATCC 33699

Neighborhood Conservation Analysis

^* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
^* 'Small ORF' represents the entry/query analyzed.
^* Image generated using 'gggenes'(R-Package).

Neighborhood Representative Chosen(Species): NC_010503.1

Sr.No.	Domain	Co-occurrence Frequency	No. of species in which domain occurs with smORF	Median distance b/w smORF and domain bearing ORFs	Orientation relative to smORF	PFAM Information
1	PF13508.9	1.0	2	615.5	same-strand	Acetyltransferase (GNAT) domain
2	PF00583.27	1.0	2	615.5	same-strand	Acetyltransferase (GNAT) family
3	PF00849.24	1.0	2	1591.0	same-strand	RNA pseudouridylate synthase
4	PF01479.27	1.0	2	1591.0	same-strand	S4 domain