Result : Q9PQ73

Protein Information

• Protein name: Uncharacterized protein UU416
• NCBI Accession ID: AF222894.1
• Organism: Ureaplasma parvum serovar 3 (strain ATCC 700970)
• Left: 480900
• Right: 481112
• Strand: -
• Nucleotide Sequence: ATGAGTGATAAAAAAAGTGATTTTGAAAAGTTATTTGAGCGTTCAAAAGTACAAGAAACATCTATTTTCGATATTAATGATATTGATGAACAAAAACCGTACGAAGAACATTCGATTGAAGAATTATCATATATCTTAGAATATGAAAAAATTGATAAGAAAACACGTGAAAAGATCAAAAAAATTATTAAAGAGAAACAACAAAATTTATAA
• Sequence: MSDKKSDFEKLFERSKVQETSIFDINDIDEQKPYEEHSIEELSYILEYEKIDKKTREKIKKIIKEKQQNL
• Source of smORF: Swiss-Prot
• Pubmed ID: 11048724
• Functional Category: Others
• Uniprot ID: Q9PQ73
• ORF Length (Amino Acid): 70

Conservation Analysis

No. of Species: 2

Sr.No.	Left Position	Right Position	Strand	NCBI Accession id	Species Name
1	480884	481096	-	NC_010503.1	Ureaplasma parvum serovar 3 str. ATCC 27815
2	513411	513623	-	NC_011374.1	Ureaplasma urealyticum serovar 10 str. ATCC 33699

Neighborhood Conservation Analysis

^* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
^* 'Small ORF' represents the entry/query analyzed.
^* Image generated using 'gggenes'(R-Package).

Neighborhood Representative Chosen(Species): NC_010503.1

Sr.No.	Domain	Co-occurrence Frequency	No. of species in which domain occurs with smORF	Median distance b/w smORF and domain bearing ORFs	Orientation relative to smORF	PFAM Information
1	PF01367.22	1.0	2	3009.0	same-strand	5'-3' exonuclease, C-terminal SAM fold
2	PF07733.14	1.0	2	279.0	same-strand	Bacterial DNA polymerase III alpha NTPase domain
3	PF01368.22	1.0	2	509.0	same-strand	DHH family
4	PF02568.16	1.0	2	1065.5	same-strand	Thiamine biosynthesis protein (ThiI)
5	PF06508.15	1.0	2	1065.5	same-strand	Queuosine biosynthesis protein QueC