Result : Q9PPY4
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Acyl carrier protein homolog (ACP) |
| NCBI Accession ID | AF222894.1 |
| Organism | Ureaplasma parvum serovar 3 (strain ATCC 700970) |
| Left | 623865 |
| Right | 624098 |
| Strand | + |
| Nucleotide Sequence | ATGTCTATTAATATTAAAGATTTAATCATGAAAATCGCTAAGGAAAATAAAATTGCTTTAAATATGGATAATTTAAATATCGAATTAAAATCATTAGGAATTGATTCGCTAAGTGCTATGAATTTAATAATGAAAATTGAGGATCAAATTGGCGTTCAATTGCCTGATGAAAAATTATTAAAAATCAAAAATTTACGTGATTTAATTAACGCGTTTGAAGATGTATTAAAATAA |
| Sequence | MSINIKDLIMKIAKENKIALNMDNLNIELKSLGIDSLSAMNLIMKIEDQIGVQLPDEKLLKIKNLRDLINAFEDVLK |
| Source of smORF | Swiss-Prot |
| Function | Carrier of the growing fatty acid chain in fatty acid biosynthesis. {ECO:0000250}. |
| Pubmed ID | 11048724 |
| Domain | CDD:415812 |
| Functional Category | Others |
| Uniprot ID | Q9PPY4 |
| ORF Length (Amino Acid) | 77 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 623850 | 624083 | + | NC_010503.1 | Ureaplasma parvum serovar 3 str. ATCC 27815 |
| 2 | 702887 | 703120 | + | NC_011374.1 | Ureaplasma urealyticum serovar 10 str. ATCC 33699 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_010503.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF17533.4 | 1.0 | 2 | 85.5 | same-strand | Family of unknown function (DUF5452) |
++ More..