Result : Q9PN25
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | DNA-directed RNA polymerase subunit omega (RNAP omega subunit) (EC 2.7.7.6) (RNA polymerase omega subunit) (Transcriptase subunit omega) |
| NCBI Accession ID | AL111168.1 |
| Organism | Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) |
| Left | 1206775 |
| Right | 1206999 |
| Strand | - |
| Nucleotide Sequence | ATGGATAAAAGAATAGAAGAAGTAGCGGCAAAAGCTTTGGAAAAAATGGGTAATGATAGATATCGCCTTTCTTTAGTGGTAGCAAAAAGAGCGGAACAATTGGCAAATGGAGCAACCCCTTTGGTAGACTTTGATAAAAATAAAAATAAACTTGCAGATATAGCTTTATATGAAATTGCAGAAAATAAAATCACTTTAGAGGGTTTAGTTGAAACCAATCGATGA |
| Sequence | MDKRIEEVAAKALEKMGNDRYRLSLVVAKRAEQLANGATPLVDFDKNKNKLADIALYEIAENKITLEGLVETNR |
| Source of smORF | Swiss-Prot |
| Function | Promotes RNA polymerase assembly. Latches the N- and C-terminal regions of the beta' subunit thereby facilitating its interaction with the beta and alpha subunits (By similarity). {ECO:0000250}. |
| Pubmed ID | 10688204 |
| Domain | CDD:417484 |
| Functional Category | Others |
| Uniprot ID | Q9PN25 |
| ORF Length (Amino Acid) | 74 |
++ More..
| Conservation Analysis |
No. of Species: 47
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1206775 | 1206999 | - | NC_002163.1 | Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819 |
| 2 | 128778 | 129002 | + | NZ_CP031611.1 | Campylobacter hepaticus |
| 3 | 472854 | 473075 | + | NZ_CP020478.1 | Campylobacter helveticus |
| 4 | 1403380 | 1403598 | - | NZ_CP020867.1 | Campylobacter cuniculorum DSM 23162 = LMG 24588 |
| 5 | 1177329 | 1177550 | - | NZ_CP053849.1 | Campylobacter upsaliensis RM3940 |
| 6 | 643581 | 643799 | + | NZ_CP053825.1 | Campylobacter armoricus |
| 7 | 559775 | 559993 | + | NZ_CP007770.1 | Campylobacter insulaenigrae NCTC 12927 |
| 8 | 585970 | 586188 | + | NC_012039.1 | Campylobacter lari RM2100 |
| 9 | 1300020 | 1300238 | + | NZ_CP063079.1 | Campylobacter peloridis |
| 10 | 653777 | 654001 | + | NZ_CP053848.1 | Campylobacter ornithocola |
| 11 | 579923 | 580141 | + | NZ_CP007774.1 | Campylobacter volucris LMG 24379 |
| 12 | 684712 | 684930 | + | NZ_CP007773.1 | Campylobacter subantarcticus LMG 24377 |
| 13 | 1204061 | 1204282 | - | NZ_CP059443.1 | Campylobacter fetus |
| 14 | 623453 | 623671 | + | NZ_CP015578.1 | Campylobacter lanienae NCTC 13004 |
| 15 | 1306299 | 1306520 | - | NZ_CP053828.1 | Campylobacter hyointestinalis subsp. lawsonii |
| 16 | 624372 | 624587 | - | NZ_CP053826.1 | Campylobacter curvus |
| 17 | 1301361 | 1301582 | - | NZ_CP010995.1 | Campylobacter iguaniorum |
| 18 | 647959 | 648177 | + | NZ_CP012544.1 | Campylobacter showae |
| 19 | 1382100 | 1382315 | - | NZ_CP012541.1 | Campylobacter concisus |
| 20 | 1703875 | 1704093 | - | NZ_CP012543.1 | Campylobacter rectus |
| 21 | 1995282 | 1995485 | - | NZ_AP014724.1 | Sulfurospirillum cavolei |
| 22 | 827591 | 827806 | + | NZ_CP007201.1 | Sulfurospirillum multivorans DSM 12446 |
| 23 | 669839 | 670054 | + | NC_018002.1 | Sulfurospirillum barnesii SES-3 |
| 24 | 641843 | 642058 | + | NC_013512.1 | Sulfurospirillum deleyianum DSM 6946 |
| 25 | 863664 | 863879 | + | NZ_CP017111.1 | Sulfurospirillum halorespirans DSM 13726 |
| 26 | 1273948 | 1274163 | + | NZ_CP053831.1 | Campylobacter mucosalis |
| 27 | 1277041 | 1277256 | + | NZ_CP022347.1 | Campylobacter avium LMG 24591 |
| 28 | 862639 | 862848 | + | NC_014935.1 | Nitratifractor salsuginis DSM 16511 |
| 29 | 679332 | 679550 | - | NZ_CP012196.1 | Campylobacter gracilis |
| 30 | 1290150 | 1290350 | - | NZ_CP053841.1 | Campylobacter blaseri |
| 31 | 1426654 | 1426869 | + | NZ_CP012547.1 | Campylobacter pinnipediorum subsp. pinnipediorum |
| 32 | 537845 | 538063 | + | NZ_CP053842.1 | Campylobacter corcagiensis |
| 33 | 559685 | 559897 | - | NZ_AP023212.1 | Hydrogenimonas urashimensis |
| 34 | 1860650 | 1860865 | - | NC_014762.1 | Sulfuricurvum kujiense DSM 16994 |
| 35 | 660676 | 660891 | + | NZ_AP022847.1 | Nitrosophilus alvini |
| 36 | 1804818 | 1805015 | + | NZ_CP031217.1 | Halarcobacter bivalviorum |
| 37 | 785614 | 785799 | + | NZ_AP022826.1 | Nitrosophilus labii |
| 38 | 244275 | 244499 | + | NZ_LN907858.1 | Helicobacter typhlonius |
| 39 | 690063 | 690269 | + | NZ_CP011308.1 | Sulfurovum lithotrophicum |
| 40 | 810521 | 810745 | - | NC_004917.1 | Helicobacter hepaticus ATCC 51449 |
| 41 | 819043 | 819243 | - | NZ_CP031219.1 | Malaciobacter mytili LMG 24559 |
| 42 | 644160 | 644366 | + | NZ_CP063164.1 | Sulfurovum indicum |
| 43 | 1198595 | 1198816 | - | NZ_CP014991.1 | Helicobacter himalayensis |
| 44 | 1160513 | 1160731 | - | NZ_CP021886.1 | Helicobacter apodemus |
| 45 | 1045910 | 1046113 | - | NZ_CP063087.1 | Helicobacter winghamensis |
| 46 | 681562 | 681771 | + | NZ_LS483446.1 | Helicobacter mustelae |
| 47 | 425621 | 425824 | - | NZ_CP027432.2 | Caminibacter pacificus |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_002163.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01520.20 | 1.0 | 47 | 4484 | same-strand | N-acetylmuramoyl-L-alanine amidase |
| 2 | PF03060.17 | 1.0 | 47 | 3392 | same-strand | Nitronate monooxygenase |
| 3 | PF00579.27 | 1.0 | 47 | 2186 | same-strand | tRNA synthetases class I (W and Y) |
| 4 | PF13328.8 | 1.0 | 47 | -13 | same-strand | HD domain |
| 5 | PF04607.19 | 1.0 | 47 | -13 | same-strand | Region found in RelA / SpoT proteins |
| 6 | PF02824.23 | 1.0 | 47 | -13 | same-strand | TGS domain |
| 7 | PF01966.24 | 0.91 | 43 | -13 | same-strand | HD domain |
| 8 | PF00696.30 | 0.98 | 46 | 16.0 | same-strand | Amino acid kinase family |
| 9 | PF00005.29 | 0.77 | 36 | 2804.0 | same-strand | ABC transporter |
| 10 | PF02390.19 | 0.74 | 35 | 3474 | same-strand | Putative methyltransferase |
++ More..