Result : Q9PMR0
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Putative Fe(2+) transport protein A |
| NCBI Accession ID | AL111168.1 |
| Organism | Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) |
| Left | 1331090 |
| Right | 1331314 |
| Strand | + |
| Nucleotide Sequence | ATGACTTTAAACGAGTTAAAAGATGGACAAAAGGCTATTATTGTCAATTTAAACGCTCACAAAGAACTCAAAAATAGACTTTTAAGCTTTGGATTTATTAAAAATAAAAACTTGAAAAAAATTCACTCCTCTTTAAAAAATGCCACCATAATGGTAGAACTTGATACAAGTTGTGTTATCCTAAGATCTGATGAAGCTAAAACCATAGAAGTGAATCTTATATGA |
| Sequence | MTLNELKDGQKAIIVNLNAHKELKNRLLSFGFIKNKNLKKIHSSLKNATIMVELDTSCVILRSDEAKTIEVNLI |
| Source of smORF | Swiss-Prot |
| Function | Might be involved in Fe(2+) ion uptake (By similarity). {ECO:0000250|UniProtKB:P0AEL3}. |
| Pubmed ID | 10688204 16988218 |
| Domain | CDD:412598 |
| Functional Category | Others |
| Uniprot ID | Q9PMR0 |
| ORF Length (Amino Acid) | 74 |
++ More..
| Conservation Analysis |
No. of Species: 10
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1331090 | 1331314 | + | NC_002163.1 | Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819 |
| 2 | 955182 | 955406 | + | NZ_CP031611.1 | Campylobacter hepaticus |
| 3 | 252400 | 252627 | + | NC_012039.1 | Campylobacter lari RM2100 |
| 4 | 264620 | 264847 | + | NZ_CP053848.1 | Campylobacter ornithocola |
| 5 | 238134 | 238361 | + | NZ_CP053825.1 | Campylobacter armoricus |
| 6 | 244203 | 244433 | + | NZ_CP007774.1 | Campylobacter volucris LMG 24379 |
| 7 | 920305 | 920535 | + | NZ_CP063079.1 | Campylobacter peloridis |
| 8 | 1514618 | 1514842 | - | NZ_CP053849.1 | Campylobacter upsaliensis RM3940 |
| 9 | 1245681 | 1245905 | - | NZ_CP019684.1 | Campylobacter sputorum bv. paraureolyticus LMG 11764 |
| 10 | 154824 | 155063 | - | NZ_CP020478.1 | Campylobacter helveticus |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_012039.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01053.22 | 0.7 | 7 | 2808 | same-strand | Cys/Met metabolism PLP-dependent enzyme |
| 2 | PF00206.22 | 0.7 | 7 | 1438 | same-strand | Lyase |
| 3 | PF10397.11 | 0.7 | 7 | 1438 | same-strand | Adenylosuccinate lyase C-terminus |
| 4 | PF03972.16 | 0.6 | 6 | 92.5 | same-strand | MmgE/PrpD N-terminal domain |
| 5 | PF19305.1 | 0.6 | 6 | 91.5 | same-strand | MmgE/PrpD C-terminal domain |
| 6 | PF02421.20 | 1.0 | 10 | -1.5 | same-strand | Ferrous iron transport protein B |
| 7 | PF07670.16 | 1.0 | 10 | -1.5 | same-strand | Nucleoside recognition |
| 8 | PF01926.25 | 1.0 | 10 | -1.5 | same-strand | 50S ribosome-binding GTPase |
| 9 | PF07664.14 | 1.0 | 10 | -1.5 | same-strand | Ferrous iron transport protein B C terminus |
| 10 | PF01042.23 | 0.6 | 6 | 5433.0 | same-strand | Endoribonuclease L-PSP |
++ More..