Protein Information |
Information Type | Description |
---|---|
Protein name | Uncharacterized protein TC_0036 |
NCBI Accession ID | AE002160.2 |
Organism | Chlamydia muridarum (strain MoPn / Nigg) |
Left | 43144 |
Right | 43398 |
Strand | + |
Nucleotide Sequence | ATGTTTAATATGGAAAATTCGGCAGCTAAAGAAAAAACAGCCGCTCGTCAGCAATTGTTTGATTTAGAACAAGATATGCATGATTTAACGAAAGCCCATGAAATTAACACTAATGTACAGAGTAAGGTACAAAAGGTGACAGCTTCTCTTCGAGAAGGGGCTTCTAAAGAGTCTTTTGAGAAACAACATACATTGCTTGCGGGATATGTAGCTCTTCAAAAAGTGTTGGGACGTATCAACCGTAAAATGGTGTAA |
Sequence | MFNMENSAAKEKTAARQQLFDLEQDMHDLTKAHEINTNVQSKVQKVTASLREGASKESFEKQHTLLAGYVALQKVLGRINRKMV |
Source of smORF | Swiss-Prot |
Function | The ORF matches to the profile of pfam17376. Profile Description: Family of unknown function (DUF5398). This is a family of unknown function found in Chlamydiales. |
Pubmed ID | 10684935 |
Domain | CDD:375163 |
Functional Category | Others |
Uniprot ID | Q9PLQ9 |
ORF Length (Amino Acid) | 84 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 43144 | 43398 | + | NC_002620.2 | Chlamydia muridarum str. Nigg |
2 | 763363 | 763614 | + | NC_000117.1 | Chlamydia trachomatis D/UW-3/CX |
3 | 811508 | 811759 | + | NZ_LS398098.1 | Chlamydia suis |
4 | 1123495 | 1123746 | - | NC_007899.1 | Chlamydia felis Fe/C-56 |
5 | 42278 | 42529 | + | NC_003361.3 | Chlamydia caviae GPIC |
6 | 42328 | 42579 | + | NC_017287.1 | Chlamydia psittaci 6BC |
7 | 41444 | 41695 | + | NC_022439.1 | Chlamydia pecorum PV3056/3 |
8 | 473593 | 473844 | + | NZ_CP015840.1 | Chlamydia gallinacea 08-1274/3 |
9 | 793805 | 794053 | - | NC_005043.1 | Chlamydia pneumoniae TW-183 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00521.22 | 1.0 | 9 | 6723 | opposite-strand | DNA gyrase/topoisomerase IV, subunit A |
2 | PF01751.24 | 1.0 | 9 | 4911 | opposite-strand | Toprim domain |
3 | PF02518.28 | 1.0 | 9 | 4911 | opposite-strand | Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase |
4 | PF00986.23 | 1.0 | 9 | 4911 | opposite-strand | DNA gyrase B subunit, carboxyl terminus |
5 | PF05201.17 | 1.0 | 9 | 3342 | same-strand | Glutamyl-tRNAGlu reductase, N-terminal domain |
6 | PF05932.15 | 1.0 | 9 | 2537 | same-strand | Tir chaperone protein (CesT) family |
7 | PF16697.7 | 1.0 | 9 | 47 | same-strand | Inner membrane component of T3SS, cytoplasmic domain |
8 | PF00498.28 | 1.0 | 9 | 47 | same-strand | FHA domain |
9 | PF04972.19 | 0.89 | 8 | 47.0 | same-strand | BON domain |
10 | PF00006.27 | 1.0 | 9 | 1455 | same-strand | ATP synthase alpha/beta family, nucleotide-binding domain |
11 | PF18269.3 | 1.0 | 9 | 1455 | same-strand | T3SS EscN ATPase C-terminal domain |
12 | PF02874.25 | 0.89 | 8 | 1457.5 | same-strand | ATP synthase alpha/beta family, beta-barrel domain |
13 | PF16789.7 | 1.0 | 9 | 2800 | same-strand | YscO-like protein |