| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Putative membrane protein insertion efficiency factor |
| NCBI Accession ID | AE002160.2 |
| Organism | Chlamydia muridarum (strain MoPn / Nigg) |
| Left | 899655 |
| Right | 899948 |
| Strand | + |
| Nucleotide Sequence | ATGAAAACCTCTTGGATCAAGATTTTTTTTCAAGGGATGATTCACCTATACCGTTGGACTATTTCTCCTCTTCTGGGCTCCCCATGTCGGTTTTTTCCCTCTTGCTCCGAATACGCCCTTGTAGCATTGAAAAAGCATCCTTTAAAGAGAAGTCTTTTTCTAATCGCTAATCGCTTACTAAAATGTGGCCCCTGGCACATTGGAGGAATTGATCTTGTCCCTGGGACCTCTATTGAAGAATACTTAGAATCTCCTGACGACAAGAATGTCCCACCTGATCAAGAAACTGTTTAG |
| Sequence | MKTSWIKIFFQGMIHLYRWTISPLLGSPCRFFPSCSEYALVALKKHPLKRSLFLIANRLLKCGPWHIGGIDLVPGTSIEEYLESPDDKNVPPDQETV |
| Source of smORF | Swiss-Prot |
| Function | Could be involved in insertion of integral membrane proteins into the membrane. {ECO:0000255|HAMAP-Rule:MF_00386}. |
| Pubmed ID | 10684935 |
| Domain | CDD:412414 |
| Functional Category | Others |
| Uniprot ID | Q9PJS0 |
| ORF Length (Amino Acid) | 97 |
| Conservation Analysis |
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 899655 | 899948 | + | NC_002620.2 | Chlamydia muridarum str. Nigg |
| 2 | 594744 | 595076 | + | NZ_LS398098.1 | Chlamydia suis |
| 3 | 547122 | 547436 | + | NC_000117.1 | Chlamydia trachomatis D/UW-3/CX |
| 4 | 1007647 | 1007958 | + | NC_007899.1 | Chlamydia felis Fe/C-56 |
| 5 | 586195 | 586512 | - | NZ_CP015840.1 | Chlamydia gallinacea 08-1274/3 |
| 6 | 152696 | 152959 | - | NC_022439.1 | Chlamydia pecorum PV3056/3 |
| 7 | 6500568 | 6500804 | + | NZ_CP031142.1 | Saccharopolyspora pogona |
| Neighborhood Conservation Analysis |
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF13588.8 | 0.71 | 5 | 2399 | same-strand | Type I restriction enzyme R protein N terminus (HSDR N) |
| 2 | PF11967.10 | 0.71 | 5 | 1863 | same-strand | Recombination protein O N terminal |
| 3 | PF02582.16 | 0.86 | 6 | 6.5 | same-strand | Uncharacterised ACR, YagE family COG1723 |
| 4 | PF03483.19 | 0.86 | 6 | 1022.5 | same-strand | B3/4 domain |
| 5 | PF17759.3 | 0.86 | 6 | 1022.5 | same-strand | Phenylalanyl tRNA synthetase beta chain CLM domain |
| 6 | PF01588.22 | 0.86 | 6 | 1022.5 | same-strand | Putative tRNA binding domain |
| 7 | PF03147.16 | 0.86 | 6 | 1022.5 | same-strand | Ferredoxin-fold anticodon binding domain |
| 8 | PF03484.17 | 0.86 | 6 | 1022.5 | same-strand | tRNA synthetase B5 domain |
| 9 | PF00528.24 | 0.86 | 6 | 4892.0 | opposite-strand | Binding-protein-dependent transport system inner membrane component |