Result : Q9PIM5
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Probable tautomerase Cj0270 (EC 5.3.2.-) |
| NCBI Accession ID | AL111168.1 |
| Organism | Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) |
| Left | 248747 |
| Right | 248953 |
| Strand | + |
| Nucleotide Sequence | ATGCCATTAGTAAATATCAAATTAGCAAAGCCGTCTTTAAGCAAGGAGCAAAAAGCGGAACTTATAGCTGATATTACCGAACTTTTAAGCACGAAATATAATAAAAGTAAAGAAAGAGTTGTTGTGGTTTTAGAAGATGTGGAAAATTATGACATAGGCTTTGGCGGAGAAAGTGTAGAAGCTATCAAAGCAAAGGCAAGTAAATGA |
| Sequence | MPLVNIKLAKPSLSKEQKAELIADITELLSTKYNKSKERVVVVLEDVENYDIGFGGESVEAIKAKASK |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00235. Profile Description: N/A. This family includes the enzyme 4-oxalocrotonate tautomerase, which catalyzes the ketonisation of 2-hydroxymuconate to 2-oxo-3-hexenedioate. |
| Pubmed ID | 10688204 |
| Domain | CDD:412246 |
| Functional Category | Others |
| Uniprot ID | Q9PIM5 |
| ORF Length (Amino Acid) | 68 |
++ More..
| Conservation Analysis |
No. of Species: 14
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 248747 | 248953 | + | NC_002163.1 | Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819 |
| 2 | 1356438 | 1356647 | - | NZ_CP007774.1 | Campylobacter volucris LMG 24379 |
| 3 | 1397852 | 1398058 | + | NZ_CP031611.1 | Campylobacter hepaticus |
| 4 | 204957 | 205163 | + | NZ_CP053849.1 | Campylobacter upsaliensis RM3940 |
| 5 | 1569953 | 1570153 | - | NZ_CP020478.1 | Campylobacter helveticus |
| 6 | 76593 | 76793 | + | NZ_CP022347.1 | Campylobacter avium LMG 24591 |
| 7 | 1701477 | 1701689 | - | NZ_CP020867.1 | Campylobacter cuniculorum DSM 23162 = LMG 24588 |
| 8 | 1658591 | 1658797 | - | NZ_CP007773.1 | Campylobacter subantarcticus LMG 24377 |
| 9 | 1350712 | 1350918 | - | NC_012039.1 | Campylobacter lari RM2100 |
| 10 | 1472487 | 1472693 | - | NZ_CP053848.1 | Campylobacter ornithocola |
| 11 | 1427125 | 1427325 | - | NZ_CP053825.1 | Campylobacter armoricus |
| 12 | 471595 | 471801 | - | NZ_CP063079.1 | Campylobacter peloridis |
| 13 | 1308448 | 1308654 | - | NZ_CP007770.1 | Campylobacter insulaenigrae NCTC 12927 |
| 14 | 3438804 | 3439010 | + | NZ_CP047045.1 | Terricaulis silvestris |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_002163.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF09624.12 | 0.71 | 10 | 2448.5 | opposite-strand | Protein of unknown function (DUF2393) |
| 2 | PF01145.27 | 0.71 | 10 | 1041.0 | opposite-strand | SPFH domain / Band 7 family |
| 3 | PF01063.21 | 0.71 | 10 | 116.0 | opposite-strand | Amino-transferase class IV |
| 4 | PF00578.23 | 0.93 | 13 | -3 | same-strand | AhpC/TSA family |
| 5 | PF08534.12 | 0.93 | 13 | -3 | same-strand | Redoxin |
| 6 | PF02630.16 | 0.86 | 12 | -3.0 | same-strand | SCO1/SenC |
| 7 | PF02677.16 | 0.93 | 13 | 452 | same-strand | Epoxyqueuosine reductase QueH |
| 8 | PF07977.15 | 0.86 | 12 | 1597.5 | same-strand | FabA-like domain |
| 9 | PF00132.26 | 0.86 | 12 | 2037.5 | same-strand | Bacterial transferase hexapeptide (six repeats) |
| 10 | PF13720.8 | 0.86 | 12 | 2037.5 | same-strand | Udp N-acetylglucosamine O-acyltransferase; Domain 2 |
| 11 | PF07724.16 | 0.71 | 10 | 2818.0 | same-strand | AAA domain (Cdc48 subfamily) |
| 12 | PF00004.31 | 0.71 | 10 | 2818.0 | same-strand | ATPase family associated with various cellular activities (AAA) |
| 13 | PF10431.11 | 0.71 | 10 | 2818.0 | same-strand | C-terminal, D2-small domain, of ClpB protein |
| 14 | PF06689.15 | 0.71 | 10 | 2818.0 | same-strand | ClpX C4-type zinc finger |
++ More..