Result : Q9PHY8
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Flagellar hook-basal body complex protein FliE |
| NCBI Accession ID | AL111168.1 |
| Organism | Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) |
| Left | 489155 |
| Right | 489451 |
| Strand | - |
| Nucleotide Sequence | ATGAACAATATTAATGATTTAAGATTAAATAATAATATTTCAAATACCAACAAAAGTCAAAATTCCACAGGAATTGGTGATGAATTTGCCAAGATGCTTAAAAATGAAATCAATGATTTAAATAAAGCACAAGAAAGTGGAGAAGCTGCAATGACAGACATTGCCACAGGACAAGTAAAAGATTTACATCAAGCAGCTATAGCTATCACTAAAGCTGAAAGCAGCATGAAATTTATGCTAGAAGTAAGAAATAAAGCAATCAGTGCTTATAAAGAAATCACAAGAACTCAAATTTAA |
| Sequence | MNNINDLRLNNNISNTNKSQNSTGIGDEFAKMLKNEINDLNKAQESGEAAMTDIATGQVKDLHQAAIAITKAESSMKFMLEVRNKAISAYKEITRTQI |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl09139. Profile Description: Flagellar hook-basal body complex protein FliE. fliE is a component of the flagellar hook-basal body complex located possibly at (MS-ring)-rod junction. [Cellular processes, Chemotaxis and motility] |
| Pubmed ID | 10688204 |
| Domain | CDD:415593 |
| Functional Category | Others |
| Uniprot ID | Q9PHY8 |
| ORF Length (Amino Acid) | 98 |
++ More..
| Conservation Analysis |
No. of Species: 34
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 489155 | 489451 | - | NC_002163.1 | Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819 |
| 2 | 741216 | 741512 | + | NZ_CP053849.1 | Campylobacter upsaliensis RM3940 |
| 3 | 98817 | 99122 | + | NZ_CP020867.1 | Campylobacter cuniculorum DSM 23162 = LMG 24588 |
| 4 | 839181 | 839477 | + | NZ_CP020478.1 | Campylobacter helveticus |
| 5 | 898525 | 898821 | + | NZ_CP031611.1 | Campylobacter hepaticus |
| 6 | 722739 | 723035 | - | NZ_CP022347.1 | Campylobacter avium LMG 24591 |
| 7 | 1112597 | 1112893 | + | NZ_CP053848.1 | Campylobacter ornithocola |
| 8 | 1151381 | 1151674 | + | NZ_CP019684.1 | Campylobacter sputorum bv. paraureolyticus LMG 11764 |
| 9 | 1362150 | 1362413 | + | NZ_LS483446.1 | Helicobacter mustelae |
| 10 | 1434597 | 1434905 | - | NZ_CP035946.1 | Campylobacter canadensis |
| 11 | 1687035 | 1687301 | - | NC_013512.1 | Sulfurospirillum deleyianum DSM 6946 |
| 12 | 1232493 | 1232786 | - | NZ_CP053831.1 | Campylobacter mucosalis |
| 13 | 1296137 | 1296433 | + | NZ_CP053826.1 | Campylobacter curvus |
| 14 | 765098 | 765355 | + | NZ_AP014724.1 | Sulfurospirillum cavolei |
| 15 | 1710973 | 1711242 | - | NC_018002.1 | Sulfurospirillum barnesii SES-3 |
| 16 | 555257 | 555547 | + | NZ_CP012547.1 | Campylobacter pinnipediorum subsp. pinnipediorum |
| 17 | 2272088 | 2272390 | + | NC_014762.1 | Sulfuricurvum kujiense DSM 16994 |
| 18 | 719047 | 719334 | - | NZ_CP059443.1 | Campylobacter fetus |
| 19 | 1216627 | 1216932 | + | NZ_AP023212.1 | Hydrogenimonas urashimensis |
| 20 | 2082819 | 2083115 | - | NZ_CP017111.1 | Sulfurospirillum halorespirans DSM 13726 |
| 21 | 2233794 | 2234090 | - | NZ_CP007201.1 | Sulfurospirillum multivorans DSM 12446 |
| 22 | 753417 | 753704 | - | NZ_CP010995.1 | Campylobacter iguaniorum |
| 23 | 1347827 | 1348120 | + | NC_004917.1 | Helicobacter hepaticus ATCC 51449 |
| 24 | 365154 | 365453 | - | NC_007575.1 | Sulfurimonas denitrificans DSM 1251 |
| 25 | 188413 | 188709 | - | NZ_CP021886.1 | Helicobacter apodemus |
| 26 | 461443 | 461766 | - | NZ_CP014991.1 | Helicobacter himalayensis |
| 27 | 1580803 | 1581120 | + | NZ_CP063087.1 | Helicobacter winghamensis |
| 28 | 702572 | 702865 | - | NZ_CP012541.1 | Campylobacter concisus |
| 29 | 1659777 | 1660070 | - | NZ_CP027432.2 | Caminibacter pacificus |
| 30 | 796986 | 797276 | - | NZ_CP053828.1 | Campylobacter hyointestinalis subsp. lawsonii |
| 31 | 671074 | 671364 | - | NZ_CP015578.1 | Campylobacter lanienae NCTC 13004 |
| 32 | 1158548 | 1158835 | - | NZ_AP018676.1 | Helicobacter cinaedi |
| 33 | 266938 | 267234 | + | NZ_CP040463.1 | Caminibacter mediatlanticus TB-2 |
| 34 | 2047793 | 2048098 | - | NZ_CP035928.1 | Malaciobacter pacificus |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_002163.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00905.24 | 0.97 | 33 | 7.0 | same-strand | Penicillin binding protein transpeptidase domain |
| 2 | PF03717.17 | 0.97 | 33 | 7 | same-strand | Penicillin-binding Protein dimerisation domain |
++ More..