Result : Q9PEF4
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | FAD assembly factor SdhE |
| NCBI Accession ID | AE003849.1 |
| Organism | Xylella fastidiosa (strain 9a5c) |
| Left | 1030888 |
| Right | 1031181 |
| Strand | + |
| Nucleotide Sequence | TTGTGCTATTGCGGATGCCAGCGTGCTACTGCCGAGGAACCGACGATGGATGAACCGGCTGAATTGAACAAACTACGTTGGCGTAGCCGACGTGGGATGCGTGAATTGGATCACTTGTTTGATCGCTATCTCTCACATCGCTGGGCGCAAGCATCTGAGGCGGAGCGCGGTGTTTTCCTACGCTTTTTGGATTGTGAGGACGATAAATTGTGGCGCTGGTTGATGGGGTACGAGGTTTGTCAGGATGCGTCGTTTGCCGCTCTCATCGTTACCATCCGGGCCTTGCCTGCTTGA |
| Sequence | MCYCGCQRATAEEPTMDEPAELNKLRWRSRRGMRELDHLFDRYLSHRWAQASEAERGVFLRFLDCEDDKLWRWLMGYEVCQDASFAALIVTIRALPA |
| Source of smORF | Swiss-Prot |
| Function | An FAD assembly protein, which accelerates covalent attachment of the cofactor into other proteins. Plays an essential role in the assembly of succinate dehydrogenase (SDH, respiratory complex II), an enzyme complex that is a component of both the tricarboxylic acid cycle and the electron transport chain, and which couples the oxidation of succinate to fumarate with the reduction of ubiquinone (coenzyme Q) to ubiquinol. Required for flavinylation (covalent attachment of FAD) of the flavoprotein subunit SdhA of SDH and other flavinylated proteins as well. {ECO:0000250|UniProtKB:G4V4G2}. |
| Pubmed ID | 10910347 |
| Domain | CDD:412748 |
| Functional Category | Others |
| Uniprot ID | Q9PEF4 |
| ORF Length (Amino Acid) | 97 |
++ More..
| Conservation Analysis |
No. of Species: 20
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 444281 | 444529 | + | NC_004556.1 | Xylella fastidiosa Temecula1 |
| 2 | 562345 | 562584 | + | NZ_CP053627.1 | Xylella taiwanensis |
| 3 | 2096269 | 2096517 | - | NZ_CP046570.1 | Xanthomonas albilineans |
| 4 | 3956569 | 3956817 | + | NZ_CP043476.1 | Xanthomonas hyacinthi |
| 5 | 2574047 | 2574295 | - | NZ_CP072268.1 | Xanthomonas euvesicatoria pv. alfalfae |
| 6 | 2472957 | 2473205 | + | NZ_CP048044.1 | Xanthomonas citri |
| 7 | 2381795 | 2382043 | + | NZ_CP058243.1 | Xanthomonas campestris pv. raphani |
| 8 | 2423049 | 2423297 | + | NZ_CP028127.1 | Xanthomonas vasicola pv. vasculorum |
| 9 | 506100 | 506348 | - | NZ_CP018725.1 | Xanthomonas vesicatoria ATCC 35937 |
| 10 | 1103663 | 1103911 | - | NZ_CP016878.1 | Xanthomonas hortorum |
| 11 | 2577166 | 2577414 | + | NZ_CP033326.1 | Xanthomonas cucurbitae |
| 12 | 2304674 | 2304922 | - | NZ_CP007810.1 | Xanthomonas oryzae pv. oryzicola |
| 13 | 2632207 | 2632455 | - | NZ_LT853882.1 | Xanthomonas fragariae |
| 14 | 3269684 | 3269932 | - | NZ_CP060731.1 | Pseudoxanthomonas mexicana |
| 15 | 1891555 | 1891821 | - | NC_016147.2 | Pseudoxanthomonas spadix BD-a59 |
| 16 | 1724461 | 1724709 | + | NZ_LS483377.1 | Stenotrophomonas maltophilia |
| 17 | 301667 | 301921 | - | NZ_CP060820.1 | Lysobacter solisilvae (ex Woo and Kim 2020) |
| 18 | 1787726 | 1787974 | + | NZ_CP037883.1 | Stenotrophomonas indicatrix |
| 19 | 473752 | 474006 | - | NZ_CP060711.1 | Thermomonas brevis |
| 20 | 967185 | 967439 | - | NZ_CP029556.1 | Lysobacter oculi |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_004556.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01127.24 | 1.0 | 20 | 3109.5 | same-strand | Succinate dehydrogenase/Fumarate reductase transmembrane subunit |
| 2 | PF00890.26 | 1.0 | 20 | 1123.0 | same-strand | FAD binding domain |
| 3 | PF02910.22 | 1.0 | 20 | 1123.0 | same-strand | Fumarate reductase flavoprotein C-term |
| 4 | PF13085.8 | 1.0 | 20 | 112.5 | same-strand | 2Fe-2S iron-sulfur cluster binding domain |
| 5 | PF13534.8 | 1.0 | 20 | 112.5 | same-strand | 4Fe-4S dicluster domain |
| 6 | PF13237.8 | 1.0 | 20 | 112.5 | same-strand | 4Fe-4S dicluster domain |
| 7 | PF13183.8 | 1.0 | 20 | 112.5 | same-strand | 4Fe-4S dicluster domain |
| 8 | PF12704.9 | 0.9 | 18 | 427.0 | same-strand | MacB-like periplasmic core domain |
| 9 | PF02687.23 | 1.0 | 20 | 427.0 | same-strand | FtsX-like permease family |
| 10 | PF00005.29 | 1.0 | 20 | 1661.0 | same-strand | ABC transporter |
| 11 | PF03772.18 | 0.7 | 14 | 3922.0 | same-strand | Competence protein |
| 12 | PF13567.8 | 0.7 | 14 | 3922.0 | same-strand | Domain of unknown function (DUF4131) |
| 13 | PF00753.29 | 0.6 | 12 | 3964.5 | same-strand | Metallo-beta-lactamase superfamily |
++ More..