Protein Information |
Information Type | Description |
---|---|
Protein name | Cell division topological specificity factor |
NCBI Accession ID | CP000909.1 |
Organism | Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) |
Left | 10490 |
Right | 10765 |
Strand | - |
Nucleotide Sequence | GTGTCGTTTCTCAACGGCCTCTTCGGTCGAAAACGTGACTCCAGCGCCGAACTGGCCAAGCAACGGCTGTTGACGGTGCTGATCGACGACCGTTACAAATTGACACCGGAGATGATGGCGCAGATGAAAGCCGATCTGGCGGAAGTGCTAAAGCGCTACTTGCCGGCAATTGATGCTGAGCAGATCGAAGTCACCTTGAGTCGGGGTGAGGCTCACGATTTGCTCAAGGCTGATGTGCCGCTGCGCCGCGCAACCGATCATCCGCCGAACCGGTAG |
Sequence | MSFLNGLFGRKRDSSAELAKQRLLTVLIDDRYKLTPEMMAQMKADLAEVLKRYLPAIDAEQIEVTLSRGEAHDLLKADVPLRRATDHPPNR |
Source of smORF | Swiss-Prot |
Function | Prevents the cell division inhibition by proteins MinC and MinD at internal division sites while permitting inhibition at polar sites. This ensures cell division at the proper site by restricting the formation of a division septum at the midpoint of the long axis of the cell. {ECO:0000255|HAMAP-Rule:MF_00262}. |
Pubmed ID | 21714912 |
Domain | CDD:412433 |
Functional Category | Others |
Uniprot ID | A9WAN7 |
ORF Length (Amino Acid) | 91 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 4618380 | 4618655 | + | NC_011831.1 | Chloroflexus aggregans DSM 9485 |
2 | 4439176 | 4439439 | - | NC_009767.1 | Roseiflexus castenholzii DSM 13941 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF03775.18 | 1.0 | 2 | 874.0 | same-strand | Septum formation inhibitor MinC, C-terminal domain |
2 | PF01656.25 | 1.0 | 2 | 42.5 | same-strand | CobQ/CobB/MinD/ParA nucleotide binding domain |
3 | PF13614.8 | 1.0 | 2 | 42.5 | same-strand | AAA domain |
4 | PF01594.18 | 1.0 | 2 | 218.5 | same-strand | AI-2E family transporter |