Result : Q9PDV8
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | UPF0250 protein XF_1271 |
| NCBI Accession ID | AE003849.1 |
| Organism | Xylella fastidiosa (strain 9a5c) |
| Left | 1227529 |
| Right | 1227807 |
| Strand | - |
| Nucleotide Sequence | ATGGAGATTAAGTCCGATCATTCTGAGCATGGTTTTCAGTTCCCCGGTACGTTCGAGTTGAGCGCGGTAGGGACGGCAGGTAAGGCGCTGGAGACGGAGTTACCGCGGTTACTTGCGCGGTGTGGGGTGGAACTGGTGCAAGAGCGTATCAGTTGGAAGCATTCGTCAACCGGGAAGTATGTGTCGGTGCGGATTAGTTTCCGTGCGCTGGATCGGGAGCAATATGACGCTGCTCACCAAGTGCTGCGTGATCATCCGGAAGTGAAGTGGACGCTGTGA |
| Sequence | MEIKSDHSEHGFQFPGTFELSAVGTAGKALETELPRLLARCGVELVQERISWKHSSTGKYVSVRISFRALDREQYDAAHQVLRDHPEVKWTL |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl01102. Profile Description: Protein of unknown function (DUF493). hypothetical protein; Provisional |
| Pubmed ID | 10910347 |
| Domain | CDD:412741 |
| Functional Category | Others |
| Uniprot ID | Q9PDV8 |
| ORF Length (Amino Acid) | 92 |
++ More..
| Conservation Analysis |
No. of Species: 32
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 653259 | 653537 | - | NC_004556.1 | Xylella fastidiosa Temecula1 |
| 2 | 826419 | 826697 | + | NZ_CP053627.1 | Xylella taiwanensis |
| 3 | 1246586 | 1246864 | + | NZ_CP060731.1 | Pseudoxanthomonas mexicana |
| 4 | 801460 | 801738 | + | NZ_CP028127.1 | Xanthomonas vasicola pv. vasculorum |
| 5 | 3705185 | 3705463 | - | NZ_CP033326.1 | Xanthomonas cucurbitae |
| 6 | 844810 | 845088 | + | NZ_CP058243.1 | Xanthomonas campestris pv. raphani |
| 7 | 603702 | 603980 | + | NZ_CP007810.1 | Xanthomonas oryzae pv. oryzicola |
| 8 | 3665729 | 3666007 | - | NZ_LT853882.1 | Xanthomonas fragariae |
| 9 | 4501087 | 4501365 | + | NZ_CP016878.1 | Xanthomonas hortorum |
| 10 | 872135 | 872413 | + | NZ_CP072268.1 | Xanthomonas euvesicatoria pv. alfalfae |
| 11 | 800975 | 801253 | + | NZ_CP048044.1 | Xanthomonas citri |
| 12 | 2751864 | 2752142 | + | NZ_CP043476.1 | Xanthomonas hyacinthi |
| 13 | 3942787 | 3943065 | - | NZ_CP037883.1 | Stenotrophomonas indicatrix |
| 14 | 3798906 | 3799184 | - | NZ_LS483377.1 | Stenotrophomonas maltophilia |
| 15 | 521599 | 521877 | + | NZ_CP046603.1 | Lysobacter soli |
| 16 | 3731274 | 3731552 | + | NZ_CP018725.1 | Xanthomonas vesicatoria ATCC 35937 |
| 17 | 783754 | 784032 | + | NZ_CP012900.1 | Stenotrophomonas acidaminiphila |
| 18 | 2013666 | 2013944 | + | NZ_CP060820.1 | Lysobacter solisilvae (ex Woo and Kim 2020) |
| 19 | 512654 | 512932 | + | NC_016147.2 | Pseudoxanthomonas spadix BD-a59 |
| 20 | 875228 | 875506 | + | NZ_CP046570.1 | Xanthomonas albilineans |
| 21 | 2523103 | 2523381 | - | NZ_CP071517.1 | Lysobacter arenosi |
| 22 | 3290012 | 3290290 | - | NZ_CP041242.1 | Lysobacter alkalisoli |
| 23 | 998922 | 999200 | + | NZ_CP011129.1 | Lysobacter antibioticus |
| 24 | 858377 | 858655 | + | NZ_AP014940.1 | Lysobacter enzymogenes |
| 25 | 641851 | 642129 | + | NZ_CP029843.1 | Lysobacter maris |
| 26 | 2044256 | 2044534 | + | NZ_CP060711.1 | Thermomonas brevis |
| 27 | 5168034 | 5168312 | - | NZ_CP023465.1 | Lysobacter capsici |
| 28 | 4961203 | 4961481 | - | NZ_CP011131.1 | Lysobacter gummosus |
| 29 | 1000012 | 1000290 | + | NZ_CP023406.1 | Luteimonas chenhongjianii |
| 30 | 1848518 | 1848796 | - | NZ_CP029556.1 | Lysobacter oculi |
| 31 | 3738300 | 3738590 | + | NZ_CP014841.1 | Dyella thiooxydans |
| 32 | 452097 | 452390 | + | NC_020541.1 | Rhodanobacter denitrificans |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP028127.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF04055.23 | 0.91 | 29 | 714 | same-strand | Radical SAM superfamily |
| 2 | PF03099.21 | 0.72 | 23 | -12 | same-strand | Biotin/lipoate A/B protein ligase family |
| 3 | PF13406.8 | 0.81 | 26 | 4123.0 | same-strand | Transglycosylase SLT domain |
| 4 | PF03330.20 | 0.88 | 28 | 2834.0 | same-strand | Lytic transglycolase |
| 5 | PF05036.15 | 0.81 | 26 | 2895.5 | same-strand | SPOR domain |
| 6 | PF00768.22 | 0.94 | 30 | 1449.5 | same-strand | D-alanyl-D-alanine carboxypeptidase |
| 7 | PF07943.15 | 0.94 | 30 | 1449.5 | same-strand | Penicillin-binding protein 5, C-terminal domain |
| 8 | PF17804.3 | 0.81 | 26 | 2046.5 | same-strand | Tail specific protease N-terminal domain |
| 9 | PF03572.20 | 0.81 | 26 | 2046.5 | same-strand | Peptidase family S41 |
| 10 | PF11818.10 | 0.81 | 26 | 2046.5 | same-strand | C-terminal domain of tail specific protease (DUF3340) |
| 11 | PF00595.26 | 0.81 | 26 | 2046.5 | same-strand | PDZ domain |
| 12 | PF17820.3 | 0.78 | 25 | 2048 | same-strand | PDZ domain |
++ More..