Result : Q9PAZ9
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | UPF0125 protein XF_2346 |
| NCBI Accession ID | AE003849.1 |
| Organism | Xylella fastidiosa (strain 9a5c) |
| Left | 2225508 |
| Right | 2225750 |
| Strand | - |
| Nucleotide Sequence | GTGCTGATTGCTTGGCCGGATCGCGTTCATTGCTGTGAGATCATGTTGCAAGAAGGGGCAAGGGTGGTCGATGCGGTGGAGATGGCTGCGTTAAATGGGATCGAACAGGCAGTAGGTTATGCAGTGTTCGGAGTTTTGGTTACATCAGACCATGTGTTGAACGAGGGCGATAGGGTTGAATTGTTGCGTCCTTTGTTGATTGATCCTAAGGAGGCACGGCGCCGACGTGCTGTGTCGGCGTAA |
| Sequence | MLIAWPDRVHCCEIMLQEGARVVDAVEMAALNGIEQAVGYAVFGVLVTSDHVLNEGDRVELLRPLLIDPKEARRRRAVSA |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl28922. Profile Description: Beta-grasp ubiquitin-like fold. This domain is the binding/interacting region of several protein kinases, such as the Schizosaccharomyces pombe Byr2. Byr2 is a Ser/Thr-specific protein kinase acting as mediator of signals for sexual differentiation in S. pombe by initiating a MAPK module, which is a highly conserved element in eukaryotes. Byr2 is activated by interacting with Ras, which then translocates the molecule to the plasma membrane. Ras proteins are key elements in intracellular signaling and are involved in a variety of vital processes such as DNA transcription, growth control, and differentiation. They function like molecular switches cycling between GTP-bound 'on' and GDP-bound 'off' states. |
| Pubmed ID | 10910347 |
| Domain | CDD:421700 |
| Functional Category | Others |
| Uniprot ID | Q9PAZ9 |
| ORF Length (Amino Acid) | 80 |
++ More..
| Conservation Analysis |
No. of Species: 15
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1599421 | 1599663 | - | NC_004556.1 | Xylella fastidiosa Temecula1 |
| 2 | 1124918 | 1125118 | + | NZ_CP053627.1 | Xylella taiwanensis |
| 3 | 1691938 | 1692156 | + | NC_016147.2 | Pseudoxanthomonas spadix BD-a59 |
| 4 | 1435796 | 1436014 | + | NZ_CP007810.1 | Xanthomonas oryzae pv. oryzicola |
| 5 | 1820367 | 1820597 | + | NZ_LT853882.1 | Xanthomonas fragariae |
| 6 | 1790639 | 1790857 | + | NZ_CP072268.1 | Xanthomonas euvesicatoria pv. alfalfae |
| 7 | 904005 | 904211 | + | NZ_CP071517.1 | Lysobacter arenosi |
| 8 | 1788416 | 1788679 | + | NZ_CP048044.1 | Xanthomonas citri |
| 9 | 1767065 | 1767283 | + | NZ_CP028127.1 | Xanthomonas vasicola pv. vasculorum |
| 10 | 1475122 | 1475379 | + | NZ_CP033326.1 | Xanthomonas cucurbitae |
| 11 | 1769914 | 1770156 | + | NZ_LS483377.1 | Stenotrophomonas maltophilia |
| 12 | 2662837 | 2663103 | + | NZ_CP023465.1 | Lysobacter capsici |
| 13 | 1782187 | 1782447 | + | NZ_CP041242.1 | Lysobacter alkalisoli |
| 14 | 2596186 | 2596389 | + | NZ_CP060731.1 | Pseudoxanthomonas mexicana |
| 15 | 2585758 | 2586003 | - | NZ_CP012900.1 | Stenotrophomonas acidaminiphila |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_016147.2
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01025.21 | 0.8 | 12 | 4176.5 | same-strand | GrpE |
| 2 | PF01628.23 | 0.87 | 13 | 3341 | same-strand | HrcA protein C terminal domain |
| 3 | PF03444.17 | 0.8 | 12 | 3246.5 | same-strand | Winged helix-turn-helix transcription repressor, HrcA DNA-binding |
| 4 | PF01475.21 | 1.0 | 15 | 629 | same-strand | Ferric uptake regulator family |
| 5 | PF04355.15 | 1.0 | 15 | 45 | opposite-strand | SmpA / OmlA family |
| 6 | PF03364.22 | 1.0 | 15 | 47 | same-strand | Polyketide cyclase / dehydrase and lipid transport |
| 7 | PF01668.20 | 1.0 | 15 | 550 | opposite-strand | SmpB protein |
| 8 | PF10604.11 | 0.87 | 13 | 47 | same-strand | Polyketide cyclase / dehydrase and lipid transport |
| 9 | PF02463.21 | 0.87 | 13 | 1564 | opposite-strand | RecF/RecN/SMC N terminal domain |
++ More..