Result : Q9P9T3

Protein Information

• Protein name: Uncharacterized protein XF_1567/XF_1672
• NCBI Accession ID: AE003849.1
• Organism: Xylella fastidiosa (strain 9a5c)
• Left: 1521182
• Right: 1521415
• Strand: +
• Nucleotide Sequence: GTGAGGCAGACCCGCGTTGAGGTGATCCTCCCGCCGCAGGGGGTGTTGCAGCCGTGTGAGGCCCCGGAATTAGGGCGTGTGGACACGGTGCGTGACTTACTGAATCAGACGTTGGGATGGCGTTTTGCCTATGAGCAGTGTGCGGCGCAAGTGCGCTGTGTTGCGGCATGGGCACAGGCGGCCAGCGTCGGGCAGCCGTGGTCCGCAGATGGCTGTGGTGAAGAGGCCGAATGA
• Sequence: MRQTRVEVILPPQGVLQPCEAPELGRVDTVRDLLNQTLGWRFAYEQCAAQVRCVAAWAQAASVGQPWSADGCGEEAE
• Source of smORF: Swiss-Prot
• Pubmed ID: 10910347
• Functional Category: Others
• Uniprot ID: Q9P9T3
• ORF Length (Amino Acid): 77

Conservation Analysis

No. of Species: 2

Sr.No.	Left Position	Right Position	Strand	NCBI Accession id	Species Name
1	1198393	1198581	-	NC_004556.1	Xylella fastidiosa Temecula1
2	1307681	1307881	-	NC_004556.1	Xylella fastidiosa Temecula1
3	746960	747175	+	NZ_CP053627.1	Xylella taiwanensis
4	1555846	1556061	+	NZ_CP053627.1	Xylella taiwanensis

Neighborhood Conservation Analysis

^* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
^* 'Small ORF' represents the entry/query analyzed.
^* Image generated using 'gggenes'(R-Package).

Neighborhood Representative Chosen(Species): NC_004556.1

Sr.No.	Domain	Co-occurrence Frequency	No. of species in which domain occurs with smORF	Median distance b/w smORF and domain bearing ORFs	Orientation relative to smORF	PFAM Information
1	PF16083.7	1.0	2	465.0	same-strand	LydA holin phage, holin superfamily III
2	PF00959.21	1.0	2	785.5	same-strand	Phage lysozyme
3	PF04365.15	1.0	2	1808.0	same-strand	Ribonuclease toxin, BrnT, of type II toxin-antitoxin system