Result : Q9LCX4
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Glutamyl-tRNA(Gln) amidotransferase subunit C (Glu-ADT subunit C) (EC 6.3.5.-) |
| NCBI Accession ID | AF202446.1 |
| Organism | Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) |
| Left | 1 |
| Right | 270 |
| Strand | + |
| Nucleotide Sequence | ATGGAGCTGTCTCCCGAGCTTCTCCGCAAGCTGGAAACCCTGGCCAAAATCCGCCTATCCCCCGAGGAAGAGGCCCTGCTTTTGCAGGACCTCAAGCGGATCCTGGACTTCGTGGACGCCCTTCCCCGGGTGGAGGAAGGGGGAGCGGAGGAGGCCCTAGGCCGCCTGAGGGAGGACGAGCCCAGGCCCTCCCTGCCCCAGGCCGAGGCCCTGGCCCTGGCCCCCGAGGCGGAGGACGGCTTCTTCCGCGTGCCCCCCGTGCTGGAGTAG |
| Sequence | MELSPELLRKLETLAKIRLSPEEEALLLQDLKRILDFVDALPRVEEGGAEEALGRLREDEPRPSLPQAEALALAPEAEDGFFRVPPVLE |
| Source of smORF | Swiss-Prot |
| Function | Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln). {ECO:0000255|HAMAP-Rule:MF_00122}. |
| Pubmed ID | 10913601 |
| Domain | CDD:412411 |
| Functional Category | Others |
| Uniprot ID | Q9LCX4 |
| ORF Length (Amino Acid) | 89 |
++ More..
| Conservation Analysis |
No. of Species: 7
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 835149 | 835418 | - | NC_006461.1 | Thermus thermophilus HB8 |
| 2 | 1156106 | 1156375 | + | NZ_CP014141.1 | Thermus parvatiensis |
| 3 | 685593 | 685862 | + | NZ_CP038452.1 | Thermus caldilimi |
| 4 | 1508337 | 1508609 | + | NC_019386.1 | Thermus oshimai JL-2 |
| 5 | 960241 | 960510 | + | NZ_CP010822.1 | Thermus aquaticus Y51MC23 |
| 6 | 2006289 | 2006558 | - | NZ_CP016312.1 | Thermus brockianus |
| 7 | 1243073 | 1243360 | + | NC_015387.1 | Marinithermus hydrothermalis DSM 14884 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP038452.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01979.22 | 0.71 | 5 | 3107 | same-strand | Amidohydrolase family |
| 2 | PF13378.8 | 0.86 | 6 | 1260.5 | same-strand | Enolase C-terminal domain-like |
| 3 | PF02746.18 | 0.86 | 6 | 1260.5 | same-strand | Mandelate racemase / muconate lactonizing enzyme, N-terminal domain |
| 4 | PF00587.27 | 1.0 | 7 | 3 | same-strand | tRNA synthetase class II core domain (G, H, P, S and T) |
| 5 | PF02403.24 | 1.0 | 7 | 3 | same-strand | Seryl-tRNA synthetase N-terminal domain |
| 6 | PF04474.14 | 1.0 | 7 | 11 | same-strand | Protein of unknown function (DUF554) |
| 7 | PF00535.28 | 0.71 | 5 | 3704 | opposite-strand | Glycosyl transferase family 2 |
| 8 | PF13641.8 | 1.0 | 7 | 3704 | opposite-strand | Glycosyltransferase like family 2 |
| 9 | PF13506.8 | 0.86 | 6 | 3704.0 | opposite-strand | Glycosyl transferase family 21 |
| 10 | PF00654.22 | 0.71 | 5 | 4216 | same-strand | Voltage gated chloride channel |
++ More..