Protein Information |
Information Type | Description |
---|---|
Protein name | Glutamyl-tRNA(Gln) amidotransferase subunit C (Glu-ADT subunit C) (EC 6.3.5.-) |
NCBI Accession ID | AF202446.1 |
Organism | Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) |
Left | 1 |
Right | 270 |
Strand | + |
Nucleotide Sequence | ATGGAGCTGTCTCCCGAGCTTCTCCGCAAGCTGGAAACCCTGGCCAAAATCCGCCTATCCCCCGAGGAAGAGGCCCTGCTTTTGCAGGACCTCAAGCGGATCCTGGACTTCGTGGACGCCCTTCCCCGGGTGGAGGAAGGGGGAGCGGAGGAGGCCCTAGGCCGCCTGAGGGAGGACGAGCCCAGGCCCTCCCTGCCCCAGGCCGAGGCCCTGGCCCTGGCCCCCGAGGCGGAGGACGGCTTCTTCCGCGTGCCCCCCGTGCTGGAGTAG |
Sequence | MELSPELLRKLETLAKIRLSPEEEALLLQDLKRILDFVDALPRVEEGGAEEALGRLREDEPRPSLPQAEALALAPEAEDGFFRVPPVLE |
Source of smORF | Swiss-Prot |
Function | Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln). {ECO:0000255|HAMAP-Rule:MF_00122}. |
Pubmed ID | 10913601 |
Domain | CDD:412411 |
Functional Category | Others |
Uniprot ID | Q9LCX4 |
ORF Length (Amino Acid) | 89 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 835149 | 835418 | - | NC_006461.1 | Thermus thermophilus HB8 |
2 | 1156106 | 1156375 | + | NZ_CP014141.1 | Thermus parvatiensis |
3 | 685593 | 685862 | + | NZ_CP038452.1 | Thermus caldilimi |
4 | 1508337 | 1508609 | + | NC_019386.1 | Thermus oshimai JL-2 |
5 | 960241 | 960510 | + | NZ_CP010822.1 | Thermus aquaticus Y51MC23 |
6 | 2006289 | 2006558 | - | NZ_CP016312.1 | Thermus brockianus |
7 | 1243073 | 1243360 | + | NC_015387.1 | Marinithermus hydrothermalis DSM 14884 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF01979.22 | 0.71 | 5 | 3107 | same-strand | Amidohydrolase family |
2 | PF13378.8 | 0.86 | 6 | 1260.5 | same-strand | Enolase C-terminal domain-like |
3 | PF02746.18 | 0.86 | 6 | 1260.5 | same-strand | Mandelate racemase / muconate lactonizing enzyme, N-terminal domain |
4 | PF00587.27 | 1.0 | 7 | 3 | same-strand | tRNA synthetase class II core domain (G, H, P, S and T) |
5 | PF02403.24 | 1.0 | 7 | 3 | same-strand | Seryl-tRNA synthetase N-terminal domain |
6 | PF04474.14 | 1.0 | 7 | 11 | same-strand | Protein of unknown function (DUF554) |
7 | PF00535.28 | 0.71 | 5 | 3704 | opposite-strand | Glycosyl transferase family 2 |
8 | PF13641.8 | 1.0 | 7 | 3704 | opposite-strand | Glycosyltransferase like family 2 |
9 | PF13506.8 | 0.86 | 6 | 3704.0 | opposite-strand | Glycosyl transferase family 21 |
10 | PF00654.22 | 0.71 | 5 | 4216 | same-strand | Voltage gated chloride channel |