ProsmORF-pred
Result : Q9L5N1
Protein Information
Information Type Description
Protein name UPF0401 protein YubL
NCBI Accession ID AF250878.1
Organism Salmonella typhi
Left 96195
Right 96431
Strand +
Nucleotide Sequence ATGAGCGATTTATTCAGCAGCGAATCACCGGTAACACTGGCTCAGGCACGCACTGTCGCCGCTGGGTACCAGAACGTCTTTATCGAAAACCTCCAGCCAGCAGGCCATTTCCAGATTGTCATCCGTGATCATCGCGACCACGACAGCCAGCTGGTCTGGCGAAACTGGAATTATGAATCCGGTGCCAATGATGCGCTCAATAGCTACCTGCAAAGCCATGGGCTGAAGGCCAGTTGA
Sequence MSDLFSSESPVTLAQARTVAAGYQNVFIENLQPAGHFQIVIRDHRDHDSQLVWRNWNYESGANDALNSYLQSHGLKAS
Source of smORF Swiss-Prot
Function The ORF matches to the profile of pfam06006. Profile Description: Bacterial protein of unknown function (DUF905). This family consists of several short hypothetical Enterobacteria proteins of unknown function. Structural analysis of the surface features of the protein YvyC has revealed a single cluster of highly conserved residues on the surface. Additionally, these residues fall into two groups which lie within the two largest of the three cavities identified over the surface. The conclusion from this is that these two cavities with, Leu 58, Glu 75, Ile 82, and Glu 83 and Pro 86, conserved, are likely to be important for the molecular function and reflect the cavities found on the surface of the FlaG proteins in pfam03646.
Pubmed ID 10773089 11677608
Domain CDD:368702
Functional Category Others
Uniprot ID Q9L5N1
ORF Length (Amino Acid) 78
++ More..