Result : Q9L3B1
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | PqqA binding protein (Coenzyme PQQ synthesis protein D) (Pyrroloquinoline quinone biosynthesis protein D) |
| NCBI Accession ID | AJ277117.1 |
| Organism | Gluconobacter oxydans (strain 621H) (Gluconobacter suboxydans) |
| Left | 3397 |
| Right | 3687 |
| Strand | + |
| Nucleotide Sequence | ATGACGGAGGCCCCGCATGTCGTGGCGGAGGGGACGGTTCTCTCCTTTGCCCGGGGGCATCGTCTCCAGCACGATCGTGTGCGGGACGTGTGGATCGTGCAGGCGCCTGAAAAAGCATTTGTAGTTGAGGGCGCCGCGCCGCATATTCTGCGGCTGCTGGATGGGAAGCGCAGCGTCGGCGAGATCATCCAGCAGCTTGCAATCGAGTTTTCCGCCCCGCGTGAGGTCATTGCGAAAGATGTCCTCGCGCTTCTTTCTGAACTGACAGAAAAGAACGTCCTGCACACATGA |
| Sequence | MTEAPHVVAEGTVLSFARGHRLQHDRVRDVWIVQAPEKAFVVEGAAPHILRLLDGKRSVGEIIQQLAIEFSAPREVIAKDVLALLSELTEKNVLHT |
| Source of smORF | Swiss-Prot |
| Function | Functions as a PqqA binding protein and presents PqqA to PqqE, in the pyrroloquinoline quinone (PQQ) biosynthetic pathway. |
| Pubmed ID | 11111029 15665824 |
| Domain | CDD:414309 |
| Functional Category | Others |
| Uniprot ID | Q9L3B1 |
| ORF Length (Amino Acid) | 96 |
++ More..
| Conservation Analysis |
No. of Species: 12
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1203184 | 1203474 | - | NZ_CP004373.1 | Gluconobacter oxydans DSM 3504 |
| 2 | 1164916 | 1165206 | - | NZ_CP068419.1 | Gluconobacter sphaericus |
| 3 | 2781508 | 2781795 | - | NZ_CP014689.1 | Gluconobacter albidus |
| 4 | 1134878 | 1135132 | - | NZ_CP043043.1 | Gluconobacter thailandicus |
| 5 | 940246 | 940521 | - | NZ_CP038141.1 | Swingsia samuiensis |
| 6 | 2189762 | 2190037 | + | NZ_CP042808.1 | Acetobacter oryzoeni |
| 7 | 3196106 | 3196414 | - | NZ_AP014690.1 | Asaia bogorensis NBRC 16594 |
| 8 | 2463535 | 2463834 | + | NZ_CP022374.1 | Acetobacter oryzifermentans |
| 9 | 1033668 | 1033943 | + | NC_021991.1 | Acetobacter pasteurianus 386B |
| 10 | 938286 | 938543 | + | NZ_LN606600.1 | Acetobacter senegalensis |
| 11 | 2450747 | 2451001 | - | NZ_CP014681.1 | Kozakia baliensis |
| 12 | 1848507 | 1848782 | + | NZ_CP015164.1 | Acetobacter ascendens |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP004373.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF04055.23 | 1.0 | 12 | -3.0 | same-strand | Radical SAM superfamily |
| 2 | PF13186.8 | 1.0 | 12 | -3.0 | same-strand | Iron-sulfur cluster-binding domain |
| 3 | PF03070.18 | 1.0 | 12 | 7.5 | same-strand | TENA/THI-4/PQQC family |
| 4 | PF12706.9 | 1.0 | 12 | 737.0 | same-strand | Beta-lactamase superfamily domain |
++ More..