Result : Q9KYH3
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Chaplin-G (Chaplin-F) |
| NCBI Accession ID | AL939113.1 |
| Organism | Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) |
| Left | 219142 |
| Right | 219414 |
| Strand | + |
| Nucleotide Sequence | ATGTCTCGCATCGCGAAGGCCGCGGGTGTCGCCCTGGGCACCGGAGCCGTGGTGCTCAGCGGCACCGGCATGGCCATGGCGGACGCGGGCGCGGCGGGCGCGGCCGTCGGCTCGCCCGGTGTCCTGTCCGGCAACGTCGTCCAGGTCCCGGTGCACGTGCCGGTCAACCTCTGCGGCAACACCATCGACGTGATCGGCCTGCTGAACCCGGCCTTCGGCAACGCCTGCGAAAACGGCGACGACGACGACAAGAGCGGCGGCTACGGCGGCTGA |
| Sequence | MSRIAKAAGVALGTGAVVLSGTGMAMADAGAAGAAVGSPGVLSGNVVQVPVHVPVNLCGNTIDVIGLLNPAFGNACENGDDDDKSGGYGG |
| Source of smORF | Swiss-Prot |
| Function | One of 8 partially redundant surface-active proteins required for efficient formation of aerial mycelium; the short chaplins assemble into a hydrophobic, amyloidal fibrillar surface layer that envelopes and protects aerial hyphae and spores, presumably anchored to the long chaplins (Pubmed:12832396, Pubmed:12832397, Pubmed:15228525, Pubmed:17462011). Chaplins have an overlapping function with the surface-active SapB peptide; chaplins are essential on minimal medium while on rich medium both chaplins and SapB are required for efficient aerial hyphae formation (Pubmed:17462011). Chaplins are also involved in cell attachment to a hydrophobic surface (Pubmed:19682261). Forms amyloid fibrils in vitro probably composed of stacked beta-sheets, at low extracellular concentrations individually restores the ability to form aerial hyphae to a chaplin-deficient strain (Pubmed:21526199). A small chaplin extract (ChpD, ChpE, ChpF, ChpG and ChpH) self-assembles into 2 different amyloids; small fibrils at the air-water interface form an amiphipathic membrane that resembles spore-surface structures involved in aerial hyphae formation, and hydrophilic fibrils in solution that resemble the fibers that attach cells to a hydrophobic surface. At the air-water interface the hydrophilic surface is in contact with water (probably equivalent to the peptidoglycan layer), while the hydrophobic face is exposed to the air, making the surface of the aerial hyphae hydrophobic (Pubmed:24012833). A small chaplin extract applied to a chaplin-deficient strain restores aerial hyphae formation (Pubmed:12832396, Pubmed:12832397). The small chaplin extract forms an amyloid-like structure similar to that seen on the surface of cells without rodlets (rdlA-rdlB deletions), and is highly surface active, reducing surface tension from 72 to 26 mJ/m(2), which probably allows escape of hyphae from an aqueous environment into air (Pubmed:12832396). ChpF and ChpG are sufficient to restore the rodlet layer and hydrophobicity to a strain deleted for the other 6 chaplin genes (Pubmed:15228525). {ECO:0000269|Pubmed:12832396, ECO:0000269|Pubmed:12832397, ECO:0000269|Pubmed:15228525, ECO:0000269|Pubmed:17462011, ECO:0000269|Pubmed:19682261, ECO:0000269|Pubmed:21526199, ECO:0000269|Pubmed:24012833}. |
| Pubmed ID | 12000953 12832396 12832397 15228525 17462011 19682261 21526199 24012833 24413917 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | Q9KYH3 |
| ORF Length (Amino Acid) | 90 |
++ More..
| Conservation Analysis |
No. of Species: 83
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2561554 | 2561835 | + | NZ_AP023439.1 | Streptomyces tuirus |
| 2 | 2566068 | 2566307 | - | NZ_AP023439.1 | Streptomyces tuirus |
| 3 | 1458151 | 1458393 | - | NZ_AP023439.1 | Streptomyces tuirus |
| 4 | 6198317 | 6198583 | - | NZ_AP023440.1 | Streptomyces glomeroaurantiacus |
| 5 | 6193494 | 6193733 | + | NZ_AP023440.1 | Streptomyces glomeroaurantiacus |
| 6 | 7380256 | 7380501 | + | NZ_AP023440.1 | Streptomyces glomeroaurantiacus |
| 7 | 5971414 | 5971653 | + | NZ_CP045643.1 | Streptomyces fagopyri |
| 8 | 7116156 | 7116401 | + | NZ_CP045643.1 | Streptomyces fagopyri |
| 9 | 6589561 | 6589848 | - | NC_013929.1 | Streptomyces scabiei 87.22 |
| 10 | 6584191 | 6584430 | + | NC_013929.1 | Streptomyces scabiei 87.22 |
| 11 | 4817883 | 4818164 | + | NZ_CP023693.1 | Streptomyces cinereoruber |
| 12 | 4801483 | 4801716 | + | NZ_CP023693.1 | Streptomyces cinereoruber |
| 13 | 4814942 | 4815181 | + | NZ_CP023693.1 | Streptomyces cinereoruber |
| 14 | 3191024 | 3191314 | + | NZ_CP021978.1 | Streptomyces hawaiiensis |
| 15 | 2027177 | 2027419 | - | NZ_CP021978.1 | Streptomyces hawaiiensis |
| 16 | 2876848 | 2877156 | + | NZ_CP012382.1 | Streptomyces ambofaciens ATCC 23877 |
| 17 | 2880897 | 2881136 | - | NZ_CP012382.1 | Streptomyces ambofaciens ATCC 23877 |
| 18 | 3251706 | 3251987 | + | NZ_CP015098.1 | Streptomyces qaidamensis |
| 19 | 3269359 | 3269586 | - | NZ_CP015098.1 | Streptomyces qaidamensis |
| 20 | 3256114 | 3256353 | - | NZ_CP015098.1 | Streptomyces qaidamensis |
| 21 | 2080596 | 2080838 | - | NZ_CP015098.1 | Streptomyces qaidamensis |
| 22 | 2118505 | 2118795 | + | NZ_CP032229.1 | Streptomyces seoulensis |
| 23 | 6128383 | 6128619 | + | NZ_CP032229.1 | Streptomyces seoulensis |
| 24 | 2121520 | 2121759 | - | NZ_CP032229.1 | Streptomyces seoulensis |
| 25 | 1118676 | 1118909 | - | NZ_CP032229.1 | Streptomyces seoulensis |
| 26 | 3265542 | 3265811 | + | NZ_CP034279.1 | Streptomyces ficellus |
| 27 | 3262778 | 3263017 | + | NZ_CP034279.1 | Streptomyces ficellus |
| 28 | 2362684 | 2362950 | + | NZ_CP065253.1 | Streptomyces clavuligerus |
| 29 | 5749788 | 5750021 | + | NZ_CP065253.1 | Streptomyces clavuligerus |
| 30 | 6538627 | 6538890 | - | NZ_CP023699.1 | Streptomyces kanamyceticus |
| 31 | 6532864 | 6533103 | + | NZ_CP023699.1 | Streptomyces kanamyceticus |
| 32 | 7827223 | 7827471 | + | NZ_CP023699.1 | Streptomyces kanamyceticus |
| 33 | 6517373 | 6517606 | + | NZ_CP023699.1 | Streptomyces kanamyceticus |
| 34 | 607157 | 607438 | + | NC_010572.1 | Streptomyces griseus subsp. griseus NBRC 13350 |
| 35 | 6824866 | 6825099 | + | NC_010572.1 | Streptomyces griseus subsp. griseus NBRC 13350 |
| 36 | 1608401 | 1608634 | - | NC_010572.1 | Streptomyces griseus subsp. griseus NBRC 13350 |
| 37 | 3360536 | 3360802 | + | NZ_CP022685.1 | Streptomyces formicae |
| 38 | 3381892 | 3382125 | - | NZ_CP022685.1 | Streptomyces formicae |
| 39 | 3366306 | 3366545 | - | NZ_CP022685.1 | Streptomyces formicae |
| 40 | 7861137 | 7861418 | - | NZ_CP020563.1 | Kitasatospora albolonga |
| 41 | 1190367 | 1190600 | - | NZ_CP020563.1 | Kitasatospora albolonga |
| 42 | 6873802 | 6874035 | + | NZ_CP020563.1 | Kitasatospora albolonga |
| 43 | 8521365 | 8521649 | - | NZ_CP071139.1 | Streptomyces nojiriensis |
| 44 | 2465303 | 2465536 | - | NZ_CP071139.1 | Streptomyces nojiriensis |
| 45 | 8448791 | 8449030 | + | NZ_CP071139.1 | Streptomyces nojiriensis |
| 46 | 1501594 | 1501827 | - | NZ_CP023703.1 | Streptomyces galilaeus |
| 47 | 2829665 | 2829895 | - | NZ_CP023703.1 | Streptomyces galilaeus |
| 48 | 2813319 | 2813558 | - | NZ_CP023703.1 | Streptomyces galilaeus |
| 49 | 1130629 | 1130862 | - | NZ_CP024957.1 | Streptomyces cavourensis |
| 50 | 7346124 | 7346405 | - | NZ_CP024957.1 | Streptomyces cavourensis |
| 51 | 6359637 | 6359870 | + | NZ_CP024957.1 | Streptomyces cavourensis |
| 52 | 1215755 | 1215988 | - | NZ_CP070242.1 | Streptomyces californicus |
| 53 | 7535263 | 7535547 | - | NZ_CP070242.1 | Streptomyces californicus |
| 54 | 6658880 | 6659113 | + | NZ_CP070242.1 | Streptomyces californicus |
| 55 | 1356016 | 1356249 | - | NC_021177.1 | Streptomyces fulvissimus DSM 40593 |
| 56 | 7719339 | 7719620 | - | NC_021177.1 | Streptomyces fulvissimus DSM 40593 |
| 57 | 6810558 | 6810791 | + | NC_021177.1 | Streptomyces fulvissimus DSM 40593 |
| 58 | 1203853 | 1204086 | - | NZ_CP020570.1 | Streptomyces violaceoruber |
| 59 | 7580101 | 7580385 | - | NZ_CP020570.1 | Streptomyces violaceoruber |
| 60 | 6692820 | 6693053 | + | NZ_CP020570.1 | Streptomyces violaceoruber |
| 61 | 7294163 | 7294444 | - | NZ_CP013738.1 | Streptomyces globisporus C-1027 |
| 62 | 6436117 | 6436350 | + | NZ_CP013738.1 | Streptomyces globisporus C-1027 |
| 63 | 1420768 | 1421001 | - | NZ_CP013738.1 | Streptomyces globisporus C-1027 |
| 64 | 6101582 | 6101821 | + | NZ_CP032427.1 | Streptomyces griseorubiginosus |
| 65 | 2930950 | 2931252 | + | NZ_CP063374.1 | Streptomyces chromofuscus |
| 66 | 1646510 | 1646743 | - | NZ_CP063374.1 | Streptomyces chromofuscus |
| 67 | 2935810 | 2936049 | - | NZ_CP063374.1 | Streptomyces chromofuscus |
| 68 | 2750199 | 2750438 | + | NZ_CP023407.1 | Streptomyces fungicidicus |
| 69 | 1714229 | 1714447 | - | NZ_CP023407.1 | Streptomyces fungicidicus |
| 70 | 440778 | 441011 | - | NZ_CP029254.1 | Streptomyces spongiicola |
| 71 | 111871 | 112101 | + | NZ_CP029254.1 | Streptomyces spongiicola |
| 72 | 3806898 | 3807137 | + | NZ_CP029254.1 | Streptomyces spongiicola |
| 73 | 3806489 | 3806728 | + | NZ_CP029254.1 | Streptomyces spongiicola |
| 74 | 546292 | 546525 | - | NZ_CP029188.1 | Streptomyces tirandamycinicus |
| 75 | 1168907 | 1169140 | + | NZ_CP029188.1 | Streptomyces tirandamycinicus |
| 76 | 1172394 | 1172633 | + | NZ_CP029188.1 | Streptomyces tirandamycinicus |
| 77 | 1171988 | 1172227 | + | NZ_CP029188.1 | Streptomyces tirandamycinicus |
| 78 | 134276 | 134506 | + | NZ_CP029188.1 | Streptomyces tirandamycinicus |
| 79 | 871649 | 871930 | + | NZ_CP023701.1 | Streptomyces subrutilus |
| 80 | 206352 | 206591 | - | NZ_CP023701.1 | Streptomyces subrutilus |
| 81 | 5634300 | 5634539 | + | NZ_CP034687.1 | Streptomyces griseoviridis |
| 82 | 5639402 | 5639683 | - | NZ_CP034687.1 | Streptomyces griseoviridis |
| 83 | 567759 | 567992 | - | NZ_CP009922.3 | Streptomyces xiamenensis |
| 84 | 877002 | 877247 | - | NZ_CP009922.3 | Streptomyces xiamenensis |
| 85 | 6402506 | 6402793 | - | NZ_CP022744.1 | Streptomyces lincolnensis |
| 86 | 7644229 | 7644474 | + | NZ_CP022744.1 | Streptomyces lincolnensis |
| 87 | 7832177 | 7832410 | + | NZ_CP022744.1 | Streptomyces lincolnensis |
| 88 | 6397234 | 6397473 | + | NZ_CP022744.1 | Streptomyces lincolnensis |
| 89 | 5571041 | 5571337 | - | NZ_CP051006.1 | Streptomyces griseofuscus |
| 90 | 6668660 | 6668893 | + | NZ_CP051006.1 | Streptomyces griseofuscus |
| 91 | 5566244 | 5566483 | + | NZ_CP051006.1 | Streptomyces griseofuscus |
| 92 | 628689 | 628931 | - | NZ_CP051006.1 | Streptomyces griseofuscus |
| 93 | 6528311 | 6528550 | + | NZ_CP051006.1 | Streptomyces griseofuscus |
| 94 | 4420378 | 4420659 | + | NZ_CP051486.1 | Streptomyces pratensis |
| 95 | 5570133 | 5570366 | - | NZ_CP051486.1 | Streptomyces pratensis |
| 96 | 1722214 | 1722459 | - | NZ_CP023695.1 | Streptomyces alboniger |
| 97 | 4216895 | 4217134 | + | NZ_CP023695.1 | Streptomyces alboniger |
| 98 | 796548 | 796781 | - | NZ_CP054938.1 | Streptomyces harbinensis |
| 99 | 2329777 | 2330016 | - | NZ_CP021080.1 | Streptomyces pluripotens |
| 100 | 995669 | 995902 | - | NZ_CP031194.1 | Streptomyces paludis |
| 101 | 8081891 | 8082157 | - | NZ_CP031194.1 | Streptomyces paludis |
| 102 | 3321838 | 3322065 | - | NC_021985.1 | Streptomyces collinus Tu 365 |
| 103 | 6336773 | 6337006 | + | NZ_CP022310.1 | Streptomyces calvus |
| 104 | 6196025 | 6196270 | + | NZ_CP022310.1 | Streptomyces calvus |
| 105 | 5007728 | 5008000 | - | NZ_CP023690.1 | Streptomyces spectabilis |
| 106 | 4987817 | 4988050 | + | NZ_CP023690.1 | Streptomyces spectabilis |
| 107 | 2484000 | 2484236 | - | NZ_CP023690.1 | Streptomyces spectabilis |
| 108 | 5002429 | 5002668 | + | NZ_CP023690.1 | Streptomyces spectabilis |
| 109 | 8086615 | 8086848 | - | NZ_CP016279.1 | Streptomyces griseochromogenes |
| 110 | 8261279 | 8261524 | - | NZ_CP016279.1 | Streptomyces griseochromogenes |
| 111 | 2623032 | 2623319 | - | NZ_CP040752.1 | Streptomyces rectiverticillatus |
| 112 | 6303944 | 6304186 | - | NZ_CP040752.1 | Streptomyces rectiverticillatus |
| 113 | 2496623 | 2496898 | + | NZ_CP015866.1 | Streptomyces parvulus |
| 114 | 2500557 | 2500796 | - | NZ_CP015866.1 | Streptomyces parvulus |
| 115 | 1544955 | 1545200 | - | NZ_CP015866.1 | Streptomyces parvulus |
| 116 | 7309792 | 7310010 | + | NZ_CP023688.1 | Streptomyces rimosus |
| 117 | 1003583 | 1003822 | + | NZ_CP023688.1 | Streptomyces rimosus |
| 118 | 3693860 | 3694153 | + | NZ_CP047020.1 | Streptomyces broussonetiae |
| 119 | 3699142 | 3699381 | - | NZ_CP047020.1 | Streptomyces broussonetiae |
| 120 | 2552980 | 2553198 | - | NZ_CP047020.1 | Streptomyces broussonetiae |
| 121 | 7462983 | 7463225 | + | NC_016109.1 | Kitasatospora setae KM-6054 |
| 122 | 3756879 | 3757121 | + | NC_016109.1 | Kitasatospora setae KM-6054 |
| 123 | 3757211 | 3757498 | + | NC_016109.1 | Kitasatospora setae KM-6054 |
| 124 | 2329715 | 2329933 | - | NZ_CP034539.1 | Streptomyces cyaneochromogenes |
| 125 | 7758074 | 7758319 | + | NC_003155.5 | Streptomyces avermitilis MA-4680 = NBRC 14893 |
| 126 | 5724098 | 5724340 | - | NZ_CP030073.1 | Streptomyces cadmiisoli |
| 127 | 1548974 | 1549216 | - | NZ_CP029043.1 | Streptomyces nigra |
| 128 | 2372124 | 2372357 | - | NZ_CP020569.1 | Streptomyces gilvosporeus |
| 129 | 5217603 | 5217836 | + | NZ_CP020569.1 | Streptomyces gilvosporeus |
| 130 | 2537881 | 2538123 | - | NZ_CP020569.1 | Streptomyces gilvosporeus |
| 131 | 2923042 | 2923287 | + | NZ_CP063373.1 | Streptomyces ferrugineus |
| 132 | 4315388 | 4315627 | + | NZ_CP023698.1 | Streptomyces viridifaciens |
| 133 | 4314577 | 4314819 | - | NZ_CP023698.1 | Streptomyces viridifaciens |
| 134 | 2642145 | 2642384 | - | NZ_CP072827.1 | Streptomyces mobaraensis NBRC 13819 = DSM 40847 |
| 135 | 6680738 | 6680977 | - | NZ_CP072827.1 | Streptomyces mobaraensis NBRC 13819 = DSM 40847 |
| 136 | 3560157 | 3560396 | - | NZ_CP017316.1 | Streptomyces rubrolavendulae |
| 137 | 1071854 | 1072087 | - | NZ_CP017316.1 | Streptomyces rubrolavendulae |
| 138 | 3711413 | 3711652 | - | NZ_CP023696.1 | Streptomyces fradiae ATCC 10745 = DSM 40063 |
| 139 | 1096698 | 1096931 | - | NZ_CP023696.1 | Streptomyces fradiae ATCC 10745 = DSM 40063 |
| 140 | 3952931 | 3953173 | - | NZ_CP031264.1 | Streptacidiphilus bronchialis |
| 141 | 6476244 | 6476489 | + | NZ_CP031264.1 | Streptacidiphilus bronchialis |
| 142 | 4049771 | 4050052 | + | NZ_CP034463.1 | Streptomyces aquilus |
| 143 | 4054764 | 4055003 | - | NZ_CP034463.1 | Streptomyces aquilus |
| 144 | 199076 | 199315 | + | NZ_CP072931.1 | Streptomyces auratus AGR0001 |
| 145 | 1675885 | 1676124 | - | NZ_CP072931.1 | Streptomyces auratus AGR0001 |
| 146 | 1995691 | 1995924 | - | NZ_CP027306.1 | Streptomyces atratus |
| 147 | 3394209 | 3394478 | + | NZ_CP011340.1 | Streptomyces pristinaespiralis |
| 148 | 6652112 | 6652360 | + | NZ_CP011340.1 | Streptomyces pristinaespiralis |
| 149 | 3994409 | 3994651 | - | NZ_CP031455.1 | Streptomyces olivoreticuli subsp. olivoreticuli |
| 150 | 7940967 | 7941266 | - | NZ_CP031455.1 | Streptomyces olivoreticuli subsp. olivoreticuli |
| 151 | 7267100 | 7267384 | - | NZ_CP023702.1 | Streptomyces nitrosporeus |
| 152 | 6324043 | 6324276 | + | NZ_CP023702.1 | Streptomyces nitrosporeus |
| 153 | 579276 | 579554 | - | NZ_CP070326.1 | Streptomyces noursei |
| 154 | 2840197 | 2840439 | - | NZ_CP070326.1 | Streptomyces noursei |
| 155 | 5478834 | 5479085 | + | NZ_CP070326.1 | Streptomyces noursei |
| 156 | 2839788 | 2840033 | - | NZ_CP070326.1 | Streptomyces noursei |
| 157 | 5345047 | 5345325 | + | NZ_CP010407.1 | Streptomyces vietnamensis |
| 158 | 5340932 | 5341171 | + | NZ_CP010407.1 | Streptomyces vietnamensis |
| 159 | 2074683 | 2074925 | - | NZ_CP019457.1 | Streptomyces lydicus |
| 160 | 4880197 | 4880472 | + | NZ_CP029196.1 | Streptomyces venezuelae |
| 161 | 4876150 | 4876389 | + | NZ_CP029196.1 | Streptomyces venezuelae |
| 162 | 5670383 | 5670670 | + | NZ_CP059991.1 | Streptomyces gardneri |
| 163 | 5666890 | 5667129 | + | NZ_CP059991.1 | Streptomyces gardneri |
| 164 | 7516780 | 7517025 | + | NZ_CP017248.1 | Streptomyces fodineus |
| 165 | 7680704 | 7680937 | + | NZ_CP017248.1 | Streptomyces fodineus |
| 166 | 6817133 | 6817378 | + | NZ_CP026652.1 | Streptomyces dengpaensis |
| 167 | 7006110 | 7006343 | + | NZ_CP026652.1 | Streptomyces dengpaensis |
| 168 | 6025083 | 6025322 | - | NC_013131.1 | Catenulispora acidiphila DSM 44928 |
| 169 | 114178 | 114417 | + | NZ_CP045096.1 | Streptomyces phaeolivaceus |
| 170 | 3411170 | 3411457 | + | NZ_CP045096.1 | Streptomyces phaeolivaceus |
| 171 | 3416453 | 3416692 | - | NZ_CP045096.1 | Streptomyces phaeolivaceus |
| 172 | 6834057 | 6834293 | + | NZ_CP023692.1 | Streptomyces vinaceus |
| 173 | 7290886 | 7291116 | - | NZ_CP023692.1 | Streptomyces vinaceus |
| 174 | 4335216 | 4335443 | - | NZ_CP023692.1 | Streptomyces vinaceus |
| 175 | 7084096 | 7084335 | + | NZ_CP060404.1 | Streptomyces buecherae |
| 176 | 2175255 | 2175497 | - | NZ_CP023694.1 | Streptomyces coeruleorubidus |
| 177 | 4830029 | 4830304 | - | NZ_CP032698.1 | Streptomyces hundungensis |
| 178 | 4824897 | 4825136 | + | NZ_CP032698.1 | Streptomyces hundungensis |
| 179 | 6775450 | 6775683 | + | NZ_CP032698.1 | Streptomyces hundungensis |
| 180 | 4949576 | 4949809 | + | NZ_CP023691.1 | Streptomyces platensis |
| 181 | 1402259 | 1402504 | - | NZ_CP042266.1 | Streptomyces qinzhouensis |
| 182 | 5045245 | 5045499 | - | NZ_CP042266.1 | Streptomyces qinzhouensis |
| 183 | 1580075 | 1580320 | - | NZ_CP020700.1 | Streptomyces tsukubensis |
| 184 | 5182462 | 5182716 | - | NZ_CP020700.1 | Streptomyces tsukubensis |
| 185 | 363691 | 363930 | - | NC_016111.1 | Streptomyces cattleya NRRL 8057 = DSM 46488 |
| 186 | 7667616 | 7667861 | + | NZ_CP023689.1 | Streptomyces chartreusis |
| 187 | 5333367 | 5333621 | + | NZ_LN831790.1 | Streptomyces leeuwenhoekii |
| 188 | 6375538 | 6375771 | + | NZ_LN831790.1 | Streptomyces leeuwenhoekii |
| 189 | 2873036 | 2873290 | - | NZ_CP010849.1 | Streptomyces cyaneogriseus subsp. noncyanogenus |
| 190 | 1798935 | 1799168 | - | NZ_CP010849.1 | Streptomyces cyaneogriseus subsp. noncyanogenus |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP045643.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF03777.15 | 0.66 | 55 | 202 | same-strand | ChpA-C |
++ More..