Result : A9W613
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | DNA gyrase inhibitor YacG |
| NCBI Accession ID | CP000908.1 |
| Organism | Methylorubrum extorquens (strain PA1) (Methylobacterium extorquens) |
| Left | 2942754 |
| Right | 2942972 |
| Strand | - |
| Nucleotide Sequence | ATGAGCCAGTCGGTGAAGAGGACGGCGGCGGACAAGCCGCTGGCGCCCTGTCCGATCTGCGGCAAGCCGGCTCGGACCGAAACCAAGCCGTTCTGCTCGCCCCGCTGCGCCGACATCGACCTCGGACGCTGGCTCGGCGAGCGCTACGTCATTCCGGGGCCGGAGGAGGAGGAGATGTCCTACCCACCCCGTTCGGACGACGAAAACCGCTCCCGCTGA |
| Sequence | MSQSVKRTAADKPLAPCPICGKPARTETKPFCSPRCADIDLGRWLGERYVIPGPEEEEMSYPPRSDDENRSR |
| Source of smORF | Swiss-Prot |
| Function | Inhibits all the catalytic activities of DNA gyrase by preventing its interaction with DNA. Acts by binding directly to the C-terminal domain of GyrB, which probably disrupts DNA binding by the gyrase. {ECO:0000255|HAMAP-Rule:MF_00649}. |
| Pubmed ID | |
| Domain | CDD:412768 |
| Functional Category | Metal-binding |
| Uniprot ID | A9W613 |
| ORF Length (Amino Acid) | 72 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2710846 | 2711049 | - | NZ_CP039546.1 | Methylorubrum populi |
| 2 | 835992 | 836213 | - | NC_011666.1 | Methylocella silvestris BL2 |
| 3 | 1477170 | 1477382 | + | NZ_AP014648.1 | Methyloceanibacter caenitepidi |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_011666.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02545.16 | 1.0 | 3 | -3 | same-strand | Maf-like protein |
| 2 | PF01176.21 | 0.67 | 2 | 734.0 | same-strand | Translation initiation factor 1A / IF-1 |
++ More..