Protein Information |
Information Type | Description |
---|---|
Protein name | DNA gyrase inhibitor YacG |
NCBI Accession ID | CP000908.1 |
Organism | Methylorubrum extorquens (strain PA1) (Methylobacterium extorquens) |
Left | 2942754 |
Right | 2942972 |
Strand | - |
Nucleotide Sequence | ATGAGCCAGTCGGTGAAGAGGACGGCGGCGGACAAGCCGCTGGCGCCCTGTCCGATCTGCGGCAAGCCGGCTCGGACCGAAACCAAGCCGTTCTGCTCGCCCCGCTGCGCCGACATCGACCTCGGACGCTGGCTCGGCGAGCGCTACGTCATTCCGGGGCCGGAGGAGGAGGAGATGTCCTACCCACCCCGTTCGGACGACGAAAACCGCTCCCGCTGA |
Sequence | MSQSVKRTAADKPLAPCPICGKPARTETKPFCSPRCADIDLGRWLGERYVIPGPEEEEMSYPPRSDDENRSR |
Source of smORF | Swiss-Prot |
Function | Inhibits all the catalytic activities of DNA gyrase by preventing its interaction with DNA. Acts by binding directly to the C-terminal domain of GyrB, which probably disrupts DNA binding by the gyrase. {ECO:0000255|HAMAP-Rule:MF_00649}. |
Pubmed ID | |
Domain | CDD:412768 |
Functional Category | Metal-binding |
Uniprot ID | A9W613 |
ORF Length (Amino Acid) | 72 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 2710846 | 2711049 | - | NZ_CP039546.1 | Methylorubrum populi |
2 | 835992 | 836213 | - | NC_011666.1 | Methylocella silvestris BL2 |
3 | 1477170 | 1477382 | + | NZ_AP014648.1 | Methyloceanibacter caenitepidi |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF02545.16 | 1.0 | 3 | -3 | same-strand | Maf-like protein |
2 | PF01176.21 | 0.67 | 2 | 734.0 | same-strand | Translation initiation factor 1A / IF-1 |