Result : Q9KUH2
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Probable oxaloacetate decarboxylase gamma chain 1 (EC 7.2.4.2) |
| NCBI Accession ID | |
| Organism | Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | |
| Sequence | MTHIGSLLLDAATLMVTGMAVVFLFLTLLVYLVQFMSRVIPQEVPEAAATPKKSQKVQPVTDSVSPQVVAAIAAAVHQHRSATAKQ |
| Source of smORF | Swiss-Prot |
| Function | Catalyzes the decarboxylation of oxaloacetate coupled to Na(+) translocation. {ECO:0000250}. |
| Pubmed ID | 10952301 |
| Domain | CDD:412911 |
| Functional Category | Others |
| Uniprot ID | Q9KUH2 |
| ORF Length (Amino Acid) | 86 |
++ More..
| Conservation Analysis |
No. of Species: 29
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 432012 | 432272 | + | NZ_AP014524.1 | Vibrio cholerae MS6 |
| 2 | 188453 | 188713 | + | NZ_CP035688.1 | Vibrio metoecus |
| 3 | 562815 | 563072 | + | NZ_CP032093.1 | Vibrio alfacsensis |
| 4 | 1992972 | 1993229 | + | NZ_CP065150.1 | Vibrio kanaloae |
| 5 | 585357 | 585614 | + | NZ_CP031781.1 | Vibrio parahaemolyticus |
| 6 | 2762276 | 2762533 | - | NC_011753.2 | Vibrio atlanticus |
| 7 | 2829071 | 2829328 | - | NZ_CP009354.1 | Vibrio tubiashii ATCC 19109 |
| 8 | 520744 | 521001 | + | NZ_CP039700.1 | Vibrio cyclitrophicus |
| 9 | 2267395 | 2267652 | - | NZ_CP014035.2 | Vibrio fluvialis |
| 10 | 2839261 | 2839518 | + | NZ_CP025792.1 | Vibrio jasicida 090810c |
| 11 | 1010828 | 1011085 | + | NC_013456.1 | Vibrio antiquarius |
| 12 | 986600 | 986857 | + | NZ_CP040990.1 | Vibrio furnissii |
| 13 | 2663358 | 2663615 | - | NZ_CP030788.1 | Vibrio campbellii |
| 14 | 2417447 | 2417704 | + | NZ_CP019959.1 | Vibrio owensii |
| 15 | 3226992 | 3227249 | - | NZ_CP009467.1 | Vibrio harveyi |
| 16 | 208558 | 208812 | + | NZ_CP016414.1 | Vibrio scophthalmi |
| 17 | 235724 | 235981 | + | NZ_CP009977.1 | Vibrio natriegens NBRC 15636 = ATCC 14048 = DSM 759 |
| 18 | 376648 | 376905 | + | NZ_CP018312.1 | Vibrio rotiferianus |
| 19 | 455700 | 455954 | + | NZ_CP022741.1 | Vibrio qinghaiensis |
| 20 | 2460716 | 2460970 | - | NZ_AP019657.1 | Vibrio ponticus |
| 21 | 416725 | 416979 | + | NZ_AP019651.1 | Vibrio taketomensis |
| 22 | 2818972 | 2819229 | - | NZ_CP044069.1 | Vibrio vulnificus |
| 23 | 111095 | 111352 | + | NZ_LT960611.1 | Vibrio tapetis subsp. tapetis |
| 24 | 2642434 | 2642688 | - | NZ_CP047475.1 | Vibrio astriarenae |
| 25 | 2998583 | 2998843 | - | NZ_CP046268.1 | Vibrio spartinae |
| 26 | 544004 | 544252 | + | NZ_AP014635.1 | Vibrio tritonius |
| 27 | 709310 | 709561 | + | NC_011312.1 | Aliivibrio salmonicida LFI1238 |
| 28 | 1284825 | 1285082 | - | NZ_CP046793.1 | Vibrio metschnikovii |
| 29 | 691212 | 691454 | - | NZ_CP014056.2 | Grimontia hollisae |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_AP014524.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00154.23 | 0.62 | 18 | 6635.0 | same-strand | recA bacterial DNA recombination protein |
| 2 | PF08423.13 | 0.62 | 18 | 6635.0 | same-strand | Rad51 |
| 3 | PF01411.21 | 0.83 | 24 | 3445.0 | same-strand | tRNA synthetases class II (A) |
| 4 | PF02272.21 | 0.83 | 24 | 3445.0 | same-strand | DHHA1 domain |
| 5 | PF07973.16 | 0.83 | 24 | 3445.0 | same-strand | Threonyl and Alanyl tRNA synthetase second additional domain |
| 6 | PF00696.30 | 0.83 | 24 | 2088.5 | same-strand | Amino acid kinase family |
| 7 | PF02599.18 | 0.86 | 25 | 1763 | same-strand | Global regulator protein family |
| 8 | PF00682.21 | 1.0 | 29 | 32 | same-strand | HMGL-like |
| 9 | PF02436.20 | 1.0 | 29 | 32 | same-strand | Conserved carboxylase domain |
| 10 | PF00364.24 | 1.0 | 29 | 32 | same-strand | Biotin-requiring enzyme |
| 11 | PF13533.8 | 0.83 | 24 | 32.0 | same-strand | Biotin-lipoyl like |
| 12 | PF03977.15 | 1.0 | 29 | 1828 | same-strand | Na+-transporting oxaloacetate decarboxylase beta subunit |
| 13 | PF13602.8 | 0.93 | 27 | 3098 | same-strand | Zinc-binding dehydrogenase |
| 14 | PF09335.13 | 0.97 | 28 | 4037.0 | same-strand | SNARE associated Golgi protein |
| 15 | PF05193.23 | 0.93 | 27 | 4503 | same-strand | Peptidase M16 inactive domain |
++ More..