Protein Information |
Information Type | Description |
---|---|
Protein name | Probable oxaloacetate decarboxylase gamma chain 2 (EC 7.2.4.2) |
NCBI Accession ID | |
Organism | Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) |
Left | |
Right | |
Strand | |
Nucleotide Sequence | |
Sequence | MQSTSLFLEGINLLTLGMGFVFIFLIFLVYATRAMSQLIVRFAPPEVPAKTTNKKASANKAKANPNQNQGELLAVLTAAVHHHKTQQKLS |
Source of smORF | Swiss-Prot |
Function | Catalyzes the decarboxylation of oxaloacetate coupled to Na(+) translocation. {ECO:0000250}. |
Pubmed ID | 10952301 |
Domain | CDD:412911 |
Functional Category | Others |
Uniprot ID | Q9KTU4 |
ORF Length (Amino Acid) | 90 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 700850 | 701122 | - | NZ_AP014524.1 | Vibrio cholerae MS6 |
2 | 444821 | 445093 | - | NZ_CP035688.1 | Vibrio metoecus |
3 | 706695 | 706961 | - | NZ_AP014636.1 | Vibrio tritonius |
4 | 2736971 | 2737237 | + | NZ_AP014635.1 | Vibrio tritonius |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00072.26 | 1.0 | 3 | 4917 | same-strand | Response regulator receiver domain |
2 | PF12431.10 | 1.0 | 3 | 4917 | same-strand | Transcriptional regulator |
3 | PF17203.6 | 1.0 | 3 | 3206 | same-strand | Single cache domain 3 |
4 | PF02518.28 | 1.0 | 3 | 3206 | same-strand | Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase |
5 | PF14501.8 | 1.0 | 3 | 3206 | same-strand | GHKL domain |
6 | PF14689.8 | 1.0 | 3 | 3206 | same-strand | Sensor kinase SpoOB-type, alpha-helical domain |
7 | PF03977.15 | 1.0 | 3 | 1839.0 | same-strand | Na+-transporting oxaloacetate decarboxylase beta subunit |
8 | PF00682.21 | 1.0 | 3 | 21.5 | same-strand | HMGL-like |
9 | PF02436.20 | 1.0 | 3 | 21.5 | same-strand | Conserved carboxylase domain |
10 | PF00364.24 | 1.0 | 3 | 21.5 | same-strand | Biotin-requiring enzyme |
11 | PF03390.17 | 1.0 | 3 | 95 | same-strand | 2-hydroxycarboxylate transporter family |
12 | PF08218.13 | 1.0 | 3 | 1718 | opposite-strand | Citrate lyase ligase C-terminal domain |
13 | PF13508.9 | 1.0 | 3 | 1718 | opposite-strand | Acetyltransferase (GNAT) domain |
14 | PF06857.13 | 1.0 | 3 | 2825 | opposite-strand | Malonate decarboxylase delta subunit (MdcD) |
15 | PF03328.16 | 1.0 | 3 | 3118 | opposite-strand | HpcH/HpaI aldolase/citrate lyase family |
16 | PF04223.14 | 1.0 | 3 | 4004 | opposite-strand | Citrate lyase, alpha subunit (CitF) |