Result : Q9KMG5
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Toxin HigB-1 |
| NCBI Accession ID | |
| Organism | Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | |
| Sequence | MALEFKDKWLEQFYEDDKRHRLIPSSIENALFRKLEILDAAQAESDLRIPPGNRFEHLEGNLKGWCSIRVNKQYRLIFQWVDGVALNTYLDPHKY |
| Source of smORF | Swiss-Prot |
| Function | Toxic component of a type II toxin-antitoxin (TA) system. Inhibits translation by cleavage of mRNA. {ECO:0000269|Pubmed:17020579, ECO:0000269|Pubmed:17085558}. |
| Pubmed ID | 10952301 17020579 17085558 |
| Domain | CDD:419697 |
| Functional Category | Toxin_type_2 |
| Uniprot ID | Q9KMG5 |
| ORF Length (Amino Acid) | 95 |
++ More..
| Conservation Analysis |
No. of Species: 41
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 377143 | 377430 | + | NZ_AP014525.1 | Vibrio cholerae MS6 |
| 2 | 569525 | 569812 | - | NZ_CP022742.1 | Vibrio qinghaiensis |
| 3 | 3773368 | 3773661 | - | NZ_CP040449.1 | Aeromonas simiae |
| 4 | 1853520 | 1853813 | + | NC_018691.1 | Alcanivorax dieselolei B5 |
| 5 | 887394 | 887687 | + | NZ_CP042382.1 | Pistricoccus aurantiacus |
| 6 | 1698175 | 1698468 | - | NZ_CP025120.1 | Kangiella profundi |
| 7 | 2158730 | 2159017 | + | NC_005126.1 | Photorhabdus laumondii subsp. laumondii TTO1 |
| 8 | 427895 | 428182 | + | NZ_CP016176.1 | Xenorhabdus hominickii |
| 9 | 2698942 | 2699235 | + | NC_006512.1 | Idiomarina loihiensis L2TR |
| 10 | 3675828 | 3676118 | - | NZ_CP037952.1 | Parashewanella spongiae |
| 11 | 2535686 | 2535976 | + | NZ_CP051183.1 | Bermanella marisrubri |
| 12 | 1981106 | 1981408 | - | NZ_CP044098.1 | Citrobacter portucalensis |
| 13 | 1644888 | 1645190 | + | NZ_CP015113.1 | Kosakonia radicincitans |
| 14 | 1915954 | 1916199 | - | NC_009792.1 | Citrobacter koseri ATCC BAA-895 |
| 15 | 1564476 | 1564727 | - | NZ_CP027107.1 | Cronobacter sakazakii |
| 16 | 4097986 | 4098288 | + | NZ_CP057657.1 | Escherichia fergusonii |
| 17 | 1816796 | 1817032 | + | NZ_CP012257.1 | Cronobacter universalis NCTC 9529 |
| 18 | 3947745 | 3948053 | - | NZ_CP023525.1 | Cedecea neteri |
| 19 | 2299398 | 2299655 | - | NZ_CP015749.1 | Pectobacterium parmentieri |
| 20 | 3069284 | 3069580 | - | NC_014664.1 | Rhodomicrobium vannielii ATCC 17100 |
| 21 | 1315624 | 1315920 | + | NC_002678.2 | Mesorhizobium japonicum MAFF 303099 |
| 22 | 275589 | 275885 | + | NZ_CP050296.1 | Mesorhizobium huakuii |
| 23 | 1077067 | 1077366 | - | NC_012108.1 | Desulfobacterium autotrophicum HRM2 |
| 24 | 3931675 | 3931974 | + | NZ_CP043318.1 | Enterobacter chengduensis |
| 25 | 3733803 | 3734099 | - | NZ_CP033507.1 | Mesorhizobium jarvisii |
| 26 | 1032541 | 1032837 | - | NZ_AP017655.1 | Sphingobium cloacae |
| 27 | 3548844 | 3549140 | - | NZ_AP014862.1 | Pseudomonas furukawaii |
| 28 | 4662982 | 4663272 | + | NZ_CP048784.1 | Serratia liquefaciens |
| 29 | 3713775 | 3714032 | - | NZ_CP034938.1 | Pectobacterium odoriferum |
| 30 | 1979253 | 1979549 | - | NZ_CP011971.1 | Steroidobacter denitrificans |
| 31 | 1607910 | 1608206 | - | NZ_CP054043.1 | Yersinia mollaretii ATCC 43969 |
| 32 | 3609488 | 3609733 | + | NZ_AP014857.1 | Escherichia albertii |
| 33 | 4717961 | 4718251 | + | NZ_LR134494.1 | Serratia quinivorans |
| 34 | 1147634 | 1147930 | - | NC_020528.1 | Sinorhizobium meliloti 2011 |
| 35 | 1967827 | 1968123 | - | NZ_CP031555.1 | Thalassospira indica |
| 36 | 4564599 | 4564889 | + | NZ_LT906479.1 | Serratia ficaria |
| 37 | 1036135 | 1036440 | - | NZ_CP067057.1 | Rahnella aceris |
| 38 | 1255805 | 1256059 | + | NC_017584.1 | Rhodospirillum rubrum F11 |
| 39 | 3453069 | 3453323 | - | NC_019973.1 | Mesorhizobium australicum WSM2073 |
| 40 | 2326697 | 2326951 | + | NZ_CP034148.1 | Pantoea agglomerans |
| 41 | 2800533 | 2800814 | + | NZ_CP021023.1 | Sedimentisphaera salicampi |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_AP014525.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01381.24 | 1.0 | 41 | 14.5 | same-strand | Helix-turn-helix |
++ More..