Result : Q9KGL3
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | UPF0213 protein BH0048 |
| NCBI Accession ID | BA000004.3 |
| Organism | Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) |
| Left | 64714 |
| Right | 64998 |
| Strand | + |
| Nucleotide Sequence | ATGAATCATTACGTGTACATATTAGAATGTAAAGATGGTAGCTGGTATACCGGATACACGACAGATGTAGACAGGCGCATAAAAAAGCATGCAAGTGGAAAAGGAGCCAAGTATACACGGGGGAGAGGACCATTTCGGCTCGTTGCCACTTGGGCCTTCCCATCTAAAGAAGAAGCGATGCGGTGGGAATATGAAGTGAAACATCTGTCACGGCGGAAAAAGGAACAGCTCGTGTCATTAAAAGGGGGTCCATATGAAAACACAACAAAGCTATCAACAACGTGA |
| Sequence | MNHYVYILECKDGSWYTGYTTDVDRRIKKHASGKGAKYTRGRGPFRLVATWAFPSKEEAMRWEYEVKHLSRRKKEQLVSLKGGPYENTTKLSTT |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl15257. Profile Description: GIY-YIG nuclease domain superfamily. This domain was identified by Iyer and colleagues. |
| Pubmed ID | 11058132 |
| Domain | CDD:417687 |
| Functional Category | Others |
| Uniprot ID | Q9KGL3 |
| ORF Length (Amino Acid) | 94 |
++ More..
| Conservation Analysis |
No. of Species: 191
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 64714 | 64998 | + | NC_002570.2 | Alkalihalobacillus halodurans C-125 |
| 2 | 42125 | 42373 | + | NC_014729.1 | Halogeometricum borinquense DSM 11551 |
| 3 | 31225 | 31515 | + | NZ_CP015378.1 | Fictibacillus phosphorivorans |
| 4 | 14170 | 14466 | + | NC_020388.1 | Natronomonas moolapensis 8.8.11 |
| 5 | 46365 | 46634 | + | NC_013791.2 | Alkalihalobacillus pseudofirmus OF4 |
| 6 | 1618899 | 1619135 | - | NZ_CP058334.1 | Natronomonas halophila |
| 7 | 2634415 | 2634708 | - | NZ_CP013862.1 | Lentibacillus amyloliquefaciens |
| 8 | 1159481 | 1159723 | - | NZ_CP022315.1 | Virgibacillus phasianinus |
| 9 | 226404 | 226646 | + | NC_014297.1 | Halalkalicoccus jeotgali B3 |
| 10 | 1338538 | 1338771 | - | NZ_CP031305.1 | Natronorubrum bangense |
| 11 | 587447 | 587737 | + | NZ_CP058579.1 | Halobaculum salinum |
| 12 | 264600 | 264893 | - | NZ_CP022437.1 | Virgibacillus necropolis |
| 13 | 43842 | 44117 | + | NZ_CP012024.1 | Bacillus smithii |
| 14 | 404944 | 405195 | + | NC_011899.1 | Halothermothrix orenii H 168 |
| 15 | 178439 | 178678 | + | NC_013967.1 | Haloferax volcanii DS2 |
| 16 | 262344 | 262583 | + | NZ_CP048738.1 | Haloferax alexandrinus |
| 17 | 176130 | 176369 | + | NZ_CP011947.1 | Haloferax gibbonsii |
| 18 | 2665594 | 2665842 | + | NZ_CP058529.1 | Halobaculum halophilum |
| 19 | 2175641 | 2175898 | - | NZ_CP008876.1 | Terribacillus goriensis |
| 20 | 53415 | 53687 | + | NC_017668.1 | Halobacillus halophilus DSM 2266 |
| 21 | 1550078 | 1550338 | - | NC_019792.1 | Natronobacterium gregoryi SP2 |
| 22 | 45535 | 45822 | + | NC_022524.1 | Bacillus infantis NRRL B-14911 |
| 23 | 3472164 | 3472412 | - | NZ_CP040637.1 | Natrinema pallidum |
| 24 | 391352 | 391585 | - | NC_007426.1 | Natronomonas pharaonis DSM 2160 |
| 25 | 1235608 | 1235856 | - | NZ_CP045488.1 | Natronorubrum aibiense |
| 26 | 1004923 | 1005186 | + | NZ_CP019285.1 | Halobiforma lacisalsi AJ5 |
| 27 | 113505 | 113756 | + | NZ_CP034145.1 | Haloplanus aerogenes |
| 28 | 822637 | 822900 | + | NZ_CP039139.1 | Haloferax mediterranei ATCC 33500 |
| 29 | 1940714 | 1940968 | + | NZ_CP069188.1 | Haloterrigena salifodinae |
| 30 | 54332 | 54577 | + | NZ_CP041666.1 | Radiobacillus deserti |
| 31 | 3866307 | 3866561 | - | NC_013743.1 | Haloterrigena turkmenica DSM 5511 |
| 32 | 2650632 | 2650892 | - | NZ_CP032416.1 | Clostridium fermenticellae |
| 33 | 1814122 | 1814403 | - | NZ_AP017558.1 | Halopenitus persicus |
| 34 | 52507 | 52749 | + | NZ_CP017962.1 | Virgibacillus halodenitrificans |
| 35 | 3759285 | 3759533 | - | NC_019962.1 | Natrinema pellirubrum DSM 15624 |
| 36 | 1851317 | 1851574 | - | NZ_CP041305.1 | Cytobacillus ciccensis |
| 37 | 3986785 | 3987039 | - | NC_019974.1 | Natronococcus occultus SP4 |
| 38 | 757193 | 757444 | + | NC_015666.1 | Halopiger xanaduensis SH-6 |
| 39 | 23331 | 23654 | - | NZ_CP058909.1 | Halosimplex pelagicum |
| 40 | 2388113 | 2388361 | - | NZ_CP022046.2 | Mammaliicoccus sciuri |
| 41 | 2803003 | 2803326 | + | NZ_CP065856.1 | Halosimplex litoreum |
| 42 | 2996752 | 2996988 | + | NZ_CP030356.1 | Salinibacter ruber |
| 43 | 2618403 | 2618636 | + | NC_012029.1 | Halorubrum lacusprofundi ATCC 49239 |
| 44 | 2333008 | 2333280 | - | NZ_CP058335.1 | Natronomonas salina |
| 45 | 2017567 | 2017839 | - | NC_021921.1 | Halorhabdus tiamatea SARL4B |
| 46 | 2431703 | 2431942 | + | NZ_LN831302.1 | Halobacterium hubeiense |
| 47 | 2940003 | 2940251 | - | NZ_CP034940.1 | Halorubrum ezzemoulense |
| 48 | 1623884 | 1624135 | - | NZ_CP019893.1 | Natrarchaeobaculum aegyptiacum |
| 49 | 2877626 | 2877904 | + | NZ_CP019327.1 | Haloterrigena daqingensis |
| 50 | 1981728 | 1981976 | - | NC_017455.1 | Halanaerobium praevalens DSM 2228 |
| 51 | 1085215 | 1085457 | + | NC_013202.1 | Halomicrobium mukohataei DSM 12286 |
| 52 | 2280409 | 2280651 | + | NZ_CP034345.1 | Haloplanus rallus |
| 53 | 3534757 | 3535056 | - | NZ_CP012502.1 | Bacillus beveridgei |
| 54 | 4282962 | 4283207 | - | NZ_CP009933.1 | Clostridium scatologenes |
| 55 | 556891 | 557142 | + | NZ_CP031150.1 | Haloplanus rubicundus |
| 56 | 40244 | 40510 | + | NZ_CP024848.1 | Oceanobacillus zhaokaii |
| 57 | 1753198 | 1753452 | - | NZ_CP025066.1 | Halalkaliarchaeum desulfuricum |
| 58 | 1472496 | 1472792 | - | NZ_CP018622.1 | Virgibacillus dokdonensis |
| 59 | 1856657 | 1856905 | - | NZ_CP071463.1 | Haloterrigena longa |
| 60 | 2733495 | 2733728 | + | NZ_CP007055.1 | Halostagnicola larsenii XH-48 |
| 61 | 286915 | 287154 | + | NC_020291.1 | Clostridium saccharoperbutylacetonicum N1-4(HMT) |
| 62 | 5618040 | 5618285 | + | NZ_CP020953.1 | Clostridium drakei |
| 63 | 4771399 | 4771644 | + | NZ_CP011803.1 | Clostridium carboxidivorans P7 |
| 64 | 2316231 | 2316485 | - | NZ_CP008747.1 | Staphylococcus hyicus |
| 65 | 2986077 | 2986313 | + | NZ_LT635479.1 | Lachnoclostridium phocaeense |
| 66 | 2329533 | 2329781 | - | NZ_LR134089.1 | Staphylococcus saprophyticus |
| 67 | 2855689 | 2855946 | - | NZ_CP019154.1 | Haloarcula taiwanensis |
| 68 | 2766395 | 2766652 | + | NZ_CP073366.1 | Haloarcula sinaiiensis ATCC 33800 |
| 69 | 2290575 | 2290832 | - | NC_006396.1 | Haloarcula marismortui ATCC 43049 |
| 70 | 1222150 | 1222422 | - | NZ_CP016804.1 | Halodesulfurarchaeum formicicum |
| 71 | 2655657 | 2655914 | - | NZ_CP011361.2 | Salimicrobium jeotgali |
| 72 | 171444 | 171692 | + | NZ_CP013911.1 | Staphylococcus haemolyticus |
| 73 | 18072 | 18395 | - | NZ_CP058910.1 | Halosimplex rubrum |
| 74 | 27308 | 27556 | + | NC_019964.1 | Halovivax ruber XH-70 |
| 75 | 43347 | 43646 | + | NZ_CP051464.1 | Bacillus mojavensis |
| 76 | 1965777 | 1966076 | - | NZ_CP029364.1 | Bacillus halotolerans |
| 77 | 49023 | 49271 | + | NC_014378.1 | Acetohalobium arabaticum DSM 5501 |
| 78 | 154818 | 155072 | + | NZ_CP053989.1 | Niallia circulans |
| 79 | 1164331 | 1164618 | - | NZ_CP032621.1 | Streptococcus gwangjuense |
| 80 | 2339117 | 2339365 | - | NZ_LT906462.1 | Mammaliicoccus stepanovicii |
| 81 | 43584 | 43844 | + | NC_004193.1 | Oceanobacillus iheyensis HTE831 |
| 82 | 2043696 | 2043926 | + | NZ_CP011564.1 | Halanaeroarchaeum sulfurireducens |
| 83 | 2236006 | 2236272 | - | NC_014654.1 | Halanaerobium hydrogeniformans |
| 84 | 1020518 | 1020781 | - | NZ_CP036170.1 | [Clostridium] scindens ATCC 35704 |
| 85 | 61858 | 62112 | + | NC_019978.1 | Halobacteroides halobius DSM 5150 |
| 86 | 2788711 | 2788941 | - | NZ_CP068053.1 | Peribacillus psychrosaccharolyticus |
| 87 | 914993 | 915244 | - | NZ_CP071376.1 | Clostridium gasigenes |
| 88 | 1919402 | 1919683 | - | NC_008261.1 | Clostridium perfringens ATCC 13124 |
| 89 | 42679 | 42951 | + | NZ_CP042593.1 | Bacillus dafuensis |
| 90 | 39025 | 39306 | + | NC_018704.1 | Amphibacillus xylanus NBRC 15112 |
| 91 | 3625798 | 3626040 | - | NZ_CP022121.1 | Dehalobacterium formicoaceticum |
| 92 | 2879375 | 2879632 | - | NC_015948.1 | Haloarcula hispanica ATCC 33960 |
| 93 | 3469026 | 3469289 | - | NZ_CP030775.1 | Clostridium butyricum |
| 94 | 1286021 | 1286308 | - | NZ_CP009761.1 | Parvimonas micra |
| 95 | 2338392 | 2338640 | + | NZ_CP068061.1 | Mammaliicoccus vitulinus |
| 96 | 1665523 | 1665774 | - | NZ_CP019573.1 | Abyssicoccus albus |
| 97 | 1894565 | 1894807 | + | NC_015275.1 | Cellulosilyticum lentocellum DSM 5427 |
| 98 | 1323457 | 1323741 | - | NZ_LR134336.1 | Streptococcus oralis ATCC 35037 |
| 99 | 43337 | 43609 | + | NZ_CP016539.2 | Planococcus plakortidis |
| 100 | 46125 | 46403 | + | NC_010556.1 | Exiguobacterium sibiricum 255-15 |
| 101 | 962345 | 962596 | + | NZ_CP014872.1 | Fructilactobacillus lindneri |
| 102 | 2305187 | 2305435 | + | NC_013158.1 | Halorhabdus utahensis DSM 12940 |
| 103 | 4146863 | 4147099 | - | NZ_CP016020.1 | Bacillus weihaiensis |
| 104 | 43352 | 43621 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 105 | 23935 | 24204 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 106 | 23499 | 23750 | + | NZ_CP024047.1 | Natrarchaeobaculum sulfurireducens |
| 107 | 938769 | 939017 | - | NZ_CP059066.1 | Koleobacter methoxysyntrophicus |
| 108 | 181574 | 181828 | + | NZ_CP045927.1 | Staphylococcus agnetis |
| 109 | 43821 | 44087 | + | NZ_CP016538.2 | Planococcus maritimus |
| 110 | 3856539 | 3856814 | - | NZ_CP013019.1 | Clostridium pasteurianum |
| 111 | 1797012 | 1797272 | + | NZ_CP029462.1 | Megasphaera stantonii |
| 112 | 1441051 | 1441314 | - | NC_015875.1 | Streptococcus pseudopneumoniae IS7493 |
| 113 | 2328254 | 2328505 | - | NZ_CP064056.1 | Staphylococcus lloydii |
| 114 | 682819 | 683052 | + | NZ_CP029487.1 | Eubacterium maltosivorans |
| 115 | 636421 | 636669 | - | NZ_CP012034.1 | Companilactobacillus ginsenosidimutans |
| 116 | 297999 | 298259 | + | NZ_CP017253.2 | Clostridium taeniosporum |
| 117 | 2456203 | 2456451 | - | NZ_CP008724.1 | Staphylococcus xylosus |
| 118 | 3781080 | 3781313 | + | NZ_CP019962.1 | Eubacterium limosum |
| 119 | 2310867 | 2311121 | - | NZ_CP054482.1 | Macrococcus bohemicus |
| 120 | 270082 | 270330 | + | NZ_CP013114.1 | Staphylococcus equorum |
| 121 | 2113797 | 2114054 | + | NZ_CP070062.1 | Coprococcus comes |
| 122 | 1692407 | 1692661 | - | NZ_CP065729.1 | Macrococcus caseolyticus |
| 123 | 2045917 | 2046150 | + | NC_014624.2 | Eubacterium callanderi |
| 124 | 3231802 | 3232044 | + | NZ_CP013659.2 | Planococcus rifietoensis |
| 125 | 43677 | 43946 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 126 | 1638635 | 1638889 | + | NZ_LT990039.1 | Massilistercora timonensis |
| 127 | 314291 | 314542 | + | NZ_CP065712.1 | Staphylococcus auricularis |
| 128 | 232459 | 232704 | + | NC_022567.1 | Adlercreutzia equolifaciens DSM 19450 |
| 129 | 1628973 | 1629221 | - | NZ_CP018199.1 | Staphylococcus succinus |
| 130 | 43721 | 43993 | + | NZ_CP059540.1 | Planococcus maritimus |
| 131 | 81471 | 81704 | - | NZ_CP033460.1 | Staphylococcus debuckii |
| 132 | 3886494 | 3886766 | - | NZ_CP011937.1 | Bacillus velezensis |
| 133 | 44782 | 45054 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 134 | 472139 | 472387 | + | NZ_LR134304.1 | Staphylococcus schweitzeri |
| 135 | 749037 | 749285 | - | NZ_CP033732.1 | Staphylococcus hominis |
| 136 | 2256582 | 2256830 | - | NZ_CP027002.1 | [Ruminococcus] gnavus ATCC 29149 |
| 137 | 2514729 | 2514989 | - | NZ_CP018776.1 | Staphylococcus condimenti |
| 138 | 2297531 | 2297785 | - | NZ_CP047361.1 | Macrococcus canis |
| 139 | 395262 | 395522 | + | NC_014387.1 | Butyrivibrio proteoclasticus B316 |
| 140 | 2430838 | 2431101 | - | NZ_CP041025.1 | Paremcibacter congregatus |
| 141 | 307398 | 307640 | + | NZ_CP016786.1 | Clostridium isatidis |
| 142 | 283719 | 283970 | + | NC_022571.1 | Clostridium saccharobutylicum DSM 13864 |
| 143 | 1585718 | 1585966 | - | NZ_CP017786.1 | Bacillus xiamenensis |
| 144 | 48172 | 48414 | + | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 145 | 74791 | 75033 | + | NZ_CP023665.1 | Bacillus paralicheniformis |
| 146 | 1060495 | 1060788 | - | NZ_LT632322.1 | Murdochiella vaginalis |
| 147 | 6178664 | 6178900 | - | NZ_CP039126.1 | Blautia producta |
| 148 | 6101290 | 6101550 | - | NZ_CP022464.2 | Enterocloster bolteae |
| 149 | 2255119 | 2255352 | - | NZ_LR134242.1 | Staphylococcus warneri |
| 150 | 1674226 | 1674474 | + | NC_022737.1 | Staphylococcus pasteuri SP1 |
| 151 | 565826 | 566086 | - | NZ_LR594050.1 | Streptococcus porcinus |
| 152 | 247124 | 247378 | + | NZ_CP043998.1 | Clostridium diolis |
| 153 | 2280650 | 2280898 | + | NZ_CP007601.1 | Staphylococcus capitis subsp. capitis |
| 154 | 1057117 | 1057365 | + | NZ_CP066042.1 | Staphylococcus saccharolyticus |
| 155 | 1488754 | 1488996 | - | NC_008593.1 | Clostridium novyi NT |
| 156 | 824842 | 825114 | + | NZ_LR134523.1 | Peptoniphilus ivorii |
| 157 | 460441 | 460740 | - | NZ_CP026363.1 | Brevibacillus agri |
| 158 | 28810 | 29040 | + | NZ_CP022413.2 | Blautia hansenii DSM 20583 |
| 159 | 690846 | 691106 | + | NZ_LR134341.1 | Streptococcus pseudoporcinus |
| 160 | 3276382 | 3276630 | - | NZ_CP040058.1 | Anaerostipes rhamnosivorans |
| 161 | 476305 | 476553 | + | NZ_LT906460.1 | Staphylococcus simiae |
| 162 | 464519 | 464764 | - | NZ_CP027770.1 | Staphylococcus felis |
| 163 | 3808295 | 3808573 | - | NZ_CP026309.1 | Salinigranum rubrum |
| 164 | 1520937 | 1521200 | - | NZ_AP012544.1 | Lacticaseibacillus casei DSM 20011 = JCM 1134 = ATCC 393 |
| 165 | 2456869 | 2457120 | - | NZ_CP012395.1 | Clostridium autoethanogenum DSM 10061 |
| 166 | 197612 | 197863 | - | NC_014328.1 | Clostridium ljungdahlii DSM 13528 |
| 167 | 1725 | 1979 | + | NZ_CP016953.1 | Streptococcus himalayensis |
| 168 | 1525357 | 1525638 | - | NZ_LS991421.1 | Lacticaseibacillus zeae |
| 169 | 745982 | 746221 | + | NC_014393.1 | Clostridium cellulovorans 743B |
| 170 | 1006434 | 1006679 | + | NZ_LT906446.1 | Megamonas hypermegale |
| 171 | 301683 | 301922 | + | NZ_CP027286.1 | Clostridium chauvoei |
| 172 | 1955047 | 1955280 | + | NZ_CP022096.2 | Staphylococcus pettenkoferi |
| 173 | 46652 | 46939 | + | NZ_CP024035.1 | Priestia aryabhattai |
| 174 | 1502668 | 1502967 | - | NZ_CP043404.1 | Bacillus safensis |
| 175 | 2560885 | 2561145 | - | NZ_CP046996.1 | Dehalobacter restrictus |
| 176 | 151689 | 151937 | + | NZ_LT906464.1 | Staphylococcus muscae |
| 177 | 22561 | 22809 | + | NZ_CP011150.1 | Bacillus altitudinis |
| 178 | 2991459 | 2991728 | + | NZ_CP046603.1 | Lysobacter soli |
| 179 | 2079573 | 2079818 | - | NZ_CP072844.1 | Psychrosphaera aestuarii |
| 180 | 116429 | 116704 | + | NZ_LR134338.1 | Brevibacillus brevis |
| 181 | 180194 | 180472 | + | NZ_CP039288.1 | Cupriavidus necator H16 |
| 182 | 1313855 | 1314094 | + | NZ_CP034543.1 | Streptococcus periodonticum |
| 183 | 527615 | 527878 | + | NZ_CP016757.1 | Cloacibacillus porcorum |
| 184 | 1050196 | 1050432 | + | NZ_CP011308.1 | Sulfurovum lithotrophicum |
| 185 | 2837501 | 2837743 | + | NZ_CP019628.1 | Pseudoalteromonas aliena |
| 186 | 1329097 | 1329336 | + | NZ_CP012805.1 | Streptococcus anginosus |
| 187 | 533011 | 533244 | - | NZ_LT906439.1 | Streptococcus merionis |
| 188 | 4776199 | 4776468 | - | NZ_CP021434.1 | Tumebacillus avium |
| 189 | 334660 | 334917 | + | NC_016630.1 | Filifactor alocis ATCC 35896 |
| 190 | 1717823 | 1718092 | + | NZ_CP022657.1 | Tumebacillus algifaecis |
| 191 | 2524864 | 2525124 | - | NC_012881.1 | Maridesulfovibrio salexigens DSM 2638 |
| 192 | 150579 | 150866 | - | NZ_CP039710.1 | Thermoactinomyces vulgaris |
++ More..