Result : Q9KGE8
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Protein translocase subunit SecE |
| NCBI Accession ID | BA000004.3 |
| Organism | Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) |
| Left | 149563 |
| Right | 149757 |
| Strand | + |
| Nucleotide Sequence | GTGGCTGGCGGCGTAAAAGGTATTGGTAAGTTTTTTGGTGATGTAGTAGCGGAGATGAAGCGAGTCTCTTGGCCGACTCGTAAGGAGCTTACTCGCTATACACTTGTTGTATTAGGGACTGTAGCGTTCATTACGGTATTCTTTGCCGTTGTTGATTATGGAATTTCCGCCCTCGTACGTGGATTGATTGAATAA |
| Sequence | MAGGVKGIGKFFGDVVAEMKRVSWPTRKELTRYTLVVLGTVAFITVFFAVVDYGISALVRGLIE |
| Source of smORF | Swiss-Prot |
| Function | Essential subunit of the Sec protein translocation channel SecYEG. Clamps together the 2 halves of SecY. May contact the channel plug during translocation. {ECO:0000255|HAMAP-Rule:MF_00422}. |
| Pubmed ID | 11058132 |
| Domain | CDD:412402 |
| Functional Category | Others |
| Uniprot ID | Q9KGE8 |
| ORF Length (Amino Acid) | 64 |
++ More..
| Conservation Analysis |
No. of Species: 104
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 149563 | 149757 | + | NC_002570.2 | Alkalihalobacillus halodurans C-125 |
| 2 | 119683 | 119877 | + | NC_013791.2 | Alkalihalobacillus pseudofirmus OF4 |
| 3 | 1608045 | 1608239 | + | NZ_CP063356.1 | Anaerobacillus isosaccharinicus |
| 4 | 78083 | 78265 | - | NZ_CP015438.1 | Anoxybacillus amylolyticus |
| 5 | 3246997 | 3247179 | + | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
| 6 | 102929 | 103111 | + | NZ_CP012152.1 | Anoxybacillus gonensis |
| 7 | 120564 | 120746 | + | NZ_CP012024.1 | Bacillus smithii |
| 8 | 500818 | 500991 | - | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
| 9 | 3299793 | 3299978 | + | NZ_CP013659.2 | Planococcus rifietoensis |
| 10 | 111012 | 111197 | + | NZ_CP016539.2 | Planococcus plakortidis |
| 11 | 111625 | 111810 | + | NZ_CP016538.2 | Planococcus maritimus |
| 12 | 111481 | 111666 | + | NZ_CP059540.1 | Planococcus maritimus |
| 13 | 132373 | 132552 | + | NC_014829.1 | Evansella cellulosilytica DSM 2522 |
| 14 | 134057 | 134242 | + | NZ_CP016543.2 | Planococcus donghaensis |
| 15 | 113919 | 114104 | + | NZ_CP016537.2 | Planococcus halocryophilus |
| 16 | 2716680 | 2716862 | - | NZ_CP068053.1 | Peribacillus psychrosaccharolyticus |
| 17 | 1176662 | 1176835 | + | NZ_CP017703.1 | Aeribacillus pallidus |
| 18 | 120032 | 120202 | + | NZ_CP042593.1 | Bacillus dafuensis |
| 19 | 3118293 | 3118454 | - | NZ_CP014342.1 | Geobacillus subterraneus |
| 20 | 122121 | 122318 | + | NZ_AP021853.1 | Sporolactobacillus terrae |
| 21 | 8394890 | 8395084 | - | NC_017672.3 | Paenibacillus mucilaginosus K02 |
| 22 | 2322491 | 2322676 | + | NZ_CP009709.1 | Weizmannia coagulans DSM 1 = ATCC 7050 |
| 23 | 367509 | 367691 | - | NZ_CP070511.1 | Parageobacillus toebii |
| 24 | 3964874 | 3965065 | + | NZ_CP016809.1 | Paenibacillus ihbetae |
| 25 | 111255 | 111413 | + | NZ_CP024035.1 | Priestia aryabhattai |
| 26 | 110457 | 110639 | + | NC_006510.1 | Geobacillus kaustophilus HTA426 |
| 27 | 2804105 | 2804287 | + | NZ_CP061470.1 | Geobacillus zalihae |
| 28 | 162697 | 162879 | - | NZ_CP018058.1 | Geobacillus thermocatenulatus |
| 29 | 2285722 | 2285904 | - | NZ_CP061472.1 | Geobacillus thermoleovorans |
| 30 | 4369497 | 4369685 | + | NZ_CP045295.1 | Paenibacillus cellulositrophicus |
| 31 | 1648638 | 1648823 | - | NZ_CP013661.2 | Planococcus kocurii |
| 32 | 114054 | 114239 | + | NZ_CP019401.1 | Planococcus faecalis |
| 33 | 101908 | 102093 | + | NZ_CP016540.2 | Planococcus versutus |
| 34 | 2555746 | 2555928 | + | NZ_CP030926.1 | Peribacillus butanolivorans |
| 35 | 4065853 | 4066035 | - | NZ_CP016020.1 | Bacillus weihaiensis |
| 36 | 118507 | 118692 | + | NZ_CP016534.2 | Planococcus antarcticus DSM 14505 |
| 37 | 126902 | 127078 | + | NC_017668.1 | Halobacillus halophilus DSM 2266 |
| 38 | 117541 | 117711 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 39 | 4154129 | 4154314 | - | NZ_CP031223.1 | Psychrobacillus glaciei |
| 40 | 113583 | 113762 | + | NZ_CP065425.1 | Heyndrickxia vini |
| 41 | 2970660 | 2970851 | - | NZ_CP054614.1 | Paenibacillus barcinonensis |
| 42 | 1969633 | 1969803 | - | NZ_CP022983.1 | Cytobacillus kochii |
| 43 | 87258 | 87428 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 44 | 253533 | 253703 | + | NZ_CP033052.1 | Bacillus vallismortis |
| 45 | 117481 | 117651 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 46 | 117246 | 117416 | + | NZ_CP051464.1 | Bacillus mojavensis |
| 47 | 1892001 | 1892171 | - | NZ_CP029364.1 | Bacillus halotolerans |
| 48 | 5722575 | 5722766 | - | NZ_CP034346.1 | Paenibacillus lutimineralis |
| 49 | 117367 | 117537 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 50 | 232536 | 232718 | + | NZ_CP053989.1 | Niallia circulans |
| 51 | 110271 | 110450 | + | NZ_CP024109.1 | Bacillus cytotoxicus |
| 52 | 3812874 | 3813044 | - | NZ_CP011937.1 | Bacillus velezensis |
| 53 | 118498 | 118668 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 54 | 4560582 | 4560776 | + | NZ_CP013652.1 | Paenibacillus naphthalenovorans |
| 55 | 104108 | 104314 | + | NZ_CP015378.1 | Fictibacillus phosphorivorans |
| 56 | 2955929 | 2956093 | + | NZ_CP038012.1 | Sporosarcina pasteurii |
| 57 | 410953 | 411138 | + | NZ_CP017560.1 | Sporosarcina ureilytica |
| 58 | 116492 | 116671 | + | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 59 | 149003 | 149182 | + | NZ_CP023665.1 | Bacillus paralicheniformis |
| 60 | 312018 | 312203 | + | NZ_CP014616.1 | Sporosarcina psychrophila |
| 61 | 124951 | 125121 | + | NZ_LT603683.1 | Bacillus glycinifermentans |
| 62 | 2769128 | 2769319 | + | NZ_CP011058.1 | Paenibacillus beijingensis |
| 63 | 109400 | 109579 | + | NZ_CP064875.1 | Bacillus toyonensis |
| 64 | 5010043 | 5010222 | - | NZ_CP040336.1 | Bacillus luti |
| 65 | 103957 | 104136 | + | NC_007530.2 | Bacillus anthracis str. 'Ames Ancestor' |
| 66 | 109318 | 109497 | + | NZ_CP032365.1 | Bacillus wiedmannii |
| 67 | 109600 | 109779 | + | NC_011725.1 | Bacillus cereus B4264 |
| 68 | 3703273 | 3703464 | + | NZ_CP035492.1 | Paenibacillus protaetiae |
| 69 | 124108 | 124281 | + | NC_004193.1 | Oceanobacillus iheyensis HTE831 |
| 70 | 2096782 | 2096946 | + | NZ_CP015108.1 | Sporosarcina ureae |
| 71 | 2458042 | 2458224 | - | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 72 | 128548 | 128715 | + | NZ_CP017962.1 | Virgibacillus halodenitrificans |
| 73 | 1392896 | 1393063 | - | NZ_CP018622.1 | Virgibacillus dokdonensis |
| 74 | 112599 | 112772 | + | NZ_CP024848.1 | Oceanobacillus zhaokaii |
| 75 | 2336360 | 2336575 | + | NZ_CP031092.1 | Salicibibacter kimchii |
| 76 | 2595777 | 2595938 | - | NZ_CP011361.2 | Salimicrobium jeotgali |
| 77 | 2303387 | 2303581 | + | NZ_CP017705.1 | Brevibacillus laterosporus DSM 25 |
| 78 | 108079 | 108240 | + | NC_010556.1 | Exiguobacterium sibiricum 255-15 |
| 79 | 141900 | 142085 | + | NZ_CP038015.1 | Paenisporosarcina antarctica |
| 80 | 2194142 | 2194324 | - | NZ_LR134242.1 | Staphylococcus warneri |
| 81 | 1774084 | 1774254 | - | NZ_CP041305.1 | Cytobacillus ciccensis |
| 82 | 985128 | 985298 | - | NZ_CP049740.1 | Jeotgalibaca arthritidis |
| 83 | 4718327 | 4718509 | + | NZ_CP018866.1 | Sutcliffiella cohnii |
| 84 | 1222940 | 1223101 | - | NZ_CP034465.1 | Jeotgalibaca ciconiae |
| 85 | 175731 | 175916 | + | NZ_CP010820.1 | Lysinibacillus fusiformis |
| 86 | 4524905 | 4525090 | - | NZ_CP006837.1 | Lysinibacillus varians |
| 87 | 219640 | 219825 | + | NZ_CP019980.1 | Lysinibacillus sphaericus |
| 88 | 2588575 | 2588769 | + | NZ_CP011388.1 | Paenibacillus swuensis |
| 89 | 29998 | 30159 | + | NZ_CP040676.1 | Exiguobacterium mexicanum |
| 90 | 127920 | 128099 | + | NZ_CP009416.1 | Jeotgalibacillus malaysiensis |
| 91 | 2562194 | 2562370 | - | NZ_CP013862.1 | Lentibacillus amyloliquefaciens |
| 92 | 555366 | 555551 | + | NZ_CP012559.1 | Companilactobacillus heilongjiangensis |
| 93 | 74669 | 74845 | - | NZ_CP020772.1 | Halobacillus mangrovi |
| 94 | 109413 | 109607 | + | NZ_CP019699.1 | Novibacillus thermophilus |
| 95 | 1998416 | 1998601 | - | NZ_CP017702.1 | Companilactobacillus farciminis KCTC 3681 = DSM 20184 |
| 96 | 1620852 | 1621037 | - | NZ_CP049366.1 | Companilactobacillus pabuli |
| 97 | 1925516 | 1925701 | - | NZ_CP040736.1 | Companilactobacillus futsaii |
| 98 | 198889 | 199098 | - | NZ_AP017312.1 | Aneurinibacillus soli |
| 99 | 3941842 | 3942012 | - | NZ_LT906450.1 | Rhodococcus rhodochrous |
| 100 | 4294608 | 4294778 | - | NZ_CP022208.1 | Rhodococcus pyridinivorans |
| 101 | 458797 | 458961 | + | NZ_CP009251.1 | Corynebacterium stationis |
| 102 | 470166 | 470351 | + | NZ_CP016843.1 | Carnobacterium divergens |
| 103 | 6203158 | 6203316 | - | NC_014391.1 | Micromonospora aurantiaca ATCC 27029 |
| 104 | 160070 | 160249 | + | NZ_CP029797.1 | Paraliobacillus zengyii |
| 105 | 413301 | 413471 | + | NZ_CP051884.1 | Cellulomonas taurus |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_002570.2
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01406.21 | 0.72 | 75 | 2690.5 | same-strand | tRNA synthetases class I (C) catalytic domain |
| 2 | PF09190.13 | 0.72 | 75 | 2690.5 | same-strand | DALR domain |
| 3 | PF00636.28 | 0.9 | 94 | 2270 | same-strand | Ribonuclease III domain |
| 4 | PF00588.21 | 0.92 | 96 | 1530 | same-strand | SpoU rRNA Methylase family |
| 5 | PF08032.14 | 0.92 | 96 | 1530 | same-strand | RNA 2'-O ribose methyltransferase substrate binding |
| 6 | PF05991.13 | 0.88 | 92 | 1018 | same-strand | YacP-like NYN domain |
| 7 | PF04542.16 | 0.92 | 96 | 285 | same-strand | Sigma-70 region 2 |
| 8 | PF08281.14 | 0.88 | 91 | 292.5 | same-strand | Sigma-70, region 4 |
| 9 | PF02357.21 | 0.96 | 100 | 113 | same-strand | Transcription termination factor nusG |
| 10 | PF00467.31 | 0.78 | 81 | 132.0 | same-strand | KOW motif |
| 11 | PF03946.16 | 1.0 | 104 | 867 | same-strand | Ribosomal protein L11, N-terminal domain |
| 12 | PF00298.21 | 1.0 | 104 | 867 | same-strand | Ribosomal protein L11, RNA binding domain |
| 13 | PF00687.23 | 1.0 | 104 | 1407 | same-strand | Ribosomal protein L1p/L10e family |
| 14 | PF00466.22 | 0.98 | 102 | 2356 | same-strand | Ribosomal protein L10 |
| 15 | PF00542.21 | 0.91 | 95 | 2900.5 | same-strand | Ribosomal protein L7/L12 C-terminal domain |
| 16 | PF16320.7 | 0.91 | 95 | 2900.5 | same-strand | Ribosomal protein L7/L12 dimerisation domain |
++ More..