Result : Q9KG78
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein BH0234 |
| NCBI Accession ID | BA000004.3 |
| Organism | Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) |
| Left | 251043 |
| Right | 251240 |
| Strand | + |
| Nucleotide Sequence | ATGATGGAGAGAATTCAGGAACTTTTAGAACAAATCGTGAAATGGTTGATCTTTACTATATTATTAGTGGCGTCGATATCTTTAATTGTTGTCTACCAACAGGGTTACATAGCAGAAGCGTTAGTTGCGCGTGCCACTCCACTTGCAATTGTTGTTGGATTATCTGCGATAGCGGCGGCGATCATTGTGAAAAAATAG |
| Sequence | MMERIQELLEQIVKWLIFTILLVASISLIVVYQQGYIAEALVARATPLAIVVGLSAIAAAIIVKK |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 11058132 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | Q9KG78 |
| ORF Length (Amino Acid) | 65 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 251043 | 251240 | + | NC_002570.2 | Alkalihalobacillus halodurans C-125 |
| 2 | 4263062 | 4263238 | - | NZ_CP006837.1 | Lysinibacillus varians |
| 3 | 481597 | 481773 | + | NZ_CP019980.1 | Lysinibacillus sphaericus |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP006837.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01804.20 | 0.67 | 2 | 4546.0 | same-strand | Penicillin amidase |
| 2 | PF03372.25 | 0.67 | 2 | 3587.5 | same-strand | Endonuclease/Exonuclease/phosphatase family |
| 3 | PF02873.18 | 0.67 | 2 | 2617.5 | same-strand | UDP-N-acetylenolpyruvoylglucosamine reductase, C-terminal domain |
| 4 | PF01565.25 | 0.67 | 2 | 2617.5 | same-strand | FAD binding domain |
| 5 | PF01638.19 | 0.67 | 2 | 2022.5 | same-strand | HxlR-like helix-turn-helix |
| 6 | PF01022.22 | 0.67 | 2 | 2022.5 | same-strand | Bacterial regulatory protein, arsR family |
| 7 | PF00903.27 | 0.67 | 2 | 1016.5 | opposite-strand | Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily |
| 8 | PF02525.19 | 0.67 | 2 | 2173.0 | same-strand | Flavodoxin-like fold |
| 9 | PF01323.22 | 0.67 | 2 | 3076.5 | same-strand | DSBA-like thioredoxin domain |
| 10 | PF13462.8 | 0.67 | 2 | 3076.5 | same-strand | Thioredoxin |
++ More..