Result : Q9KG51
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein BH0262 |
| NCBI Accession ID | BA000004.3 |
| Organism | Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) |
| Left | 283175 |
| Right | 283333 |
| Strand | - |
| Nucleotide Sequence | ATGGAGAAAACTCAGCAACAGCTTATACATGAGATTGAACACATAAGAAAATTTTTAATCGATCTCGGCGAAGATTACCCATTACATTCTCACATTGTCGTGTCATGCAGCCAAAAGCTCGACTTGCTCTTAAACGAATTTGAGCGTACGAAAGAATAG |
| Sequence | MEKTQQQLIHEIEHIRKFLIDLGEDYPLHSHIVVSCSQKLDLLLNEFERTKE |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of pfam09388. Profile Description: Spo0E like sporulation regulatory protein. Spore formation is an extreme response to starvation and can also be a component of disease transmission. Sporulation is controlled by an expanded two-component system where starvation signals result in sensor kinase activation and phosphorylation of the master sporulation response regulator Spo0A. Phosphatases such as Spo0E dephosphorylate Spo0A thereby inhibiting sporulation. This is a family of Spo0E-like phosphatases. The structure of a Bacillus anthracis member of this family has revealed an anti-parallel alpha-helical structure. |
| Pubmed ID | 11058132 |
| Domain | CDD:401369 |
| Functional Category | Others |
| Uniprot ID | Q9KG51 |
| ORF Length (Amino Acid) | 52 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 283175 | 283333 | - | NC_002570.2 | Alkalihalobacillus halodurans C-125 |
| 2 | 3573666 | 3573803 | - | NC_011830.1 | Desulfitobacterium hafniense DCB-2 |
++ More..