Protein name |
Uncharacterized protein BH0262 |
NCBI Accession ID |
BA000004.3 |
Organism |
Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) |
Left |
283175 |
Right |
283333 |
Strand |
- |
Nucleotide Sequence |
ATGGAGAAAACTCAGCAACAGCTTATACATGAGATTGAACACATAAGAAAATTTTTAATCGATCTCGGCGAAGATTACCCATTACATTCTCACATTGTCGTGTCATGCAGCCAAAAGCTCGACTTGCTCTTAAACGAATTTGAGCGTACGAAAGAATAG |
Sequence |
MEKTQQQLIHEIEHIRKFLIDLGEDYPLHSHIVVSCSQKLDLLLNEFERTKE |
Source of smORF |
Swiss-Prot |
Function |
The ORF matches to the profile of pfam09388. Profile Description: Spo0E like sporulation regulatory protein. Spore formation is an extreme response to starvation and can also be a component of disease transmission. Sporulation is controlled by an expanded two-component system where starvation signals result in sensor kinase activation and phosphorylation of the master sporulation response regulator Spo0A. Phosphatases such as Spo0E dephosphorylate Spo0A thereby inhibiting sporulation. This is a family of Spo0E-like phosphatases. The structure of a Bacillus anthracis member of this family has revealed an anti-parallel alpha-helical structure. |
Pubmed ID |
11058132
|
Domain |
CDD:401369 |
Functional Category |
Others |
Uniprot ID |
Q9KG51
|
ORF Length (Amino Acid) |
52 |