Result : Q9KFX8
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | CRISPR-associated endonuclease Cas2 (EC 3.1.-.-) |
| NCBI Accession ID | BA000004.3 |
| Organism | Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) |
| Left | 365633 |
| Right | 365923 |
| Strand | + |
| Nucleotide Sequence | ATGCTTGTTTTAATTACGTATGATGTCCAAACCTCAAGCATGGGAGGCACGAAAAGGCTTCGAAAAGTGGCCAAAGCGTGCCAAAATTATGGACAACGAGTGCAAAACTCTGTCTTTGAGTGCATTGTGGATTCAACTCAATTAACGTCGTTGAAATTAGAACTCACTAGTTTAATTGATGAAGAAAAAGACAGTTTGCGCATCTACCGATTAGGAAACAACTATAAAACCAAAGTAGAGCATATTGGAGCCAAGCCATCTATCGATTTAGAGGACCCTCTTATCTTTTAA |
| Sequence | MLVLITYDVQTSSMGGTKRLRKVAKACQNYGQRVQNSVFECIVDSTQLTSLKLELTSLIDEEKDSLRIYRLGNNYKTKVEHIGAKPSIDLEDPLIF |
| Source of smORF | Swiss-Prot |
| Function | CRISPR (clustered regularly interspaced short palindromic repeat), is an adaptive immune system that provides protection against mobile genetic elements (viruses, transposable elements and conjugative plasmids). CRISPR clusters contain sequences complementary to antecedent mobile elements and target invading nucleic acids. CRISPR clusters are transcribed and processed into CRISPR RNA (crRNA). Involved in the integration of spacer DNA into the CRISPR cassette (By similarity). Functions as a dsDNA-specific endonuclease, acting on circular and linear DNA; has no activity on ssRNA or ssDNA. {ECO:0000250, ECO:0000269|Pubmed:22942283}. |
| Pubmed ID | 11058132 22942283 |
| Domain | CDD:416272 |
| Functional Category | Metal-binding |
| Uniprot ID | Q9KFX8 |
| ORF Length (Amino Acid) | 96 |
++ More..
| Conservation Analysis |
No. of Species: 193
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 365633 | 365923 | + | NC_002570.2 | Alkalihalobacillus halodurans C-125 |
| 2 | 3249953 | 3250243 | - | NZ_CP014167.1 | Paenibacillus yonginensis |
| 3 | 264959 | 265249 | + | NZ_CP017703.1 | Aeribacillus pallidus |
| 4 | 5104706 | 5104996 | - | NZ_CP026363.1 | Brevibacillus agri |
| 5 | 2223865 | 2224155 | + | NZ_CP026363.1 | Brevibacillus agri |
| 6 | 1674793 | 1675083 | - | NZ_CP011361.2 | Salimicrobium jeotgali |
| 7 | 1542073 | 1542363 | - | NZ_CP009709.1 | Weizmannia coagulans DSM 1 = ATCC 7050 |
| 8 | 3531721 | 3532011 | - | NZ_CP065425.1 | Heyndrickxia vini |
| 9 | 2605637 | 2605927 | + | NZ_CP034248.1 | Paenibacillus lentus |
| 10 | 1386790 | 1387080 | + | NZ_CP009286.1 | Paenibacillus stellifer |
| 11 | 2062375 | 2062665 | + | NZ_CP019659.1 | Paenibacillus larvae subsp. larvae |
| 12 | 1516609 | 1516899 | + | NZ_CP009285.1 | Paenibacillus borealis |
| 13 | 3235097 | 3235387 | + | NZ_CP011058.1 | Paenibacillus beijingensis |
| 14 | 693774 | 694064 | - | NZ_CP025286.1 | Ethanoligenens harbinense YUAN-3 |
| 15 | 696526 | 696807 | + | NZ_CP013652.1 | Paenibacillus naphthalenovorans |
| 16 | 489578 | 489868 | + | NZ_CP035492.1 | Paenibacillus protaetiae |
| 17 | 1613467 | 1613757 | + | NZ_LN831776.1 | Paenibacillus riograndensis SBR5 |
| 18 | 1497548 | 1497838 | + | NZ_CP009288.1 | Paenibacillus durus |
| 19 | 172724 | 173014 | + | NC_010556.1 | Exiguobacterium sibiricum 255-15 |
| 20 | 1926163 | 1926396 | + | NC_016584.1 | Desulfosporosinus orientis DSM 765 |
| 21 | 2361388 | 2361672 | + | NC_011830.1 | Desulfitobacterium hafniense DCB-2 |
| 22 | 3836631 | 3836915 | - | NC_013216.1 | Desulfofarcimen acetoxidans DSM 771 |
| 23 | 1800182 | 1800472 | + | NC_011898.1 | Ruminiclostridium cellulolyticum H10 |
| 24 | 1537593 | 1537877 | + | NC_018068.1 | Desulfosporosinus acidiphilus SJ4 |
| 25 | 3996918 | 3997208 | + | NC_016641.1 | Paenibacillus terrae HPL-003 |
| 26 | 1435103 | 1435387 | + | NC_015589.1 | Desulfotomaculum ruminis DSM 2154 |
| 27 | 1519008 | 1519298 | - | NC_014414.1 | Parvularcula bermudensis HTCC2503 |
| 28 | 1965899 | 1966189 | + | NZ_CP036170.1 | [Clostridium] scindens ATCC 35704 |
| 29 | 1384251 | 1384541 | - | NC_014960.1 | Anaerolinea thermophila UNI-1 |
| 30 | 601110 | 601400 | + | NZ_CP022464.2 | Enterocloster bolteae |
| 31 | 3026903 | 3027193 | + | NZ_CP017786.1 | Bacillus xiamenensis |
| 32 | 3338075 | 3338365 | - | NZ_CP020028.1 | Paenibacillus kribbensis |
| 33 | 2314960 | 2315250 | + | NZ_AP023367.1 | Anaerocolumna cellulosilytica |
| 34 | 4960204 | 4960494 | + | NZ_CP054614.1 | Paenibacillus barcinonensis |
| 35 | 2189126 | 2189416 | - | NC_015437.1 | Selenomonas sputigena ATCC 35185 |
| 36 | 169986 | 170276 | + | NC_017311.1 | Desulfovibrio vulgaris RCH1 |
| 37 | 1943726 | 1944016 | - | NZ_CP046908.1 | Stappia indica |
| 38 | 1400721 | 1401011 | + | NZ_CP021023.1 | Sedimentisphaera salicampi |
| 39 | 1589316 | 1589606 | + | NC_012796.1 | Desulfovibrio magneticus RS-1 |
| 40 | 2459850 | 2460140 | + | NZ_CP012946.1 | Blastochloris viridis |
| 41 | 2133835 | 2134125 | - | NC_015732.1 | Treponema caldarium DSM 7334 |
| 42 | 5677804 | 5678094 | - | NZ_CP039126.1 | Blautia producta |
| 43 | 3375978 | 3376268 | + | NZ_CP046570.1 | Xanthomonas albilineans |
| 44 | 6141467 | 6141733 | - | NZ_CP048209.1 | Paenibacillus lycopersici |
| 45 | 615276 | 615566 | - | NC_023035.1 | Salinispira pacifica |
| 46 | 2065827 | 2066117 | - | NZ_CP022196.1 | Celeribacter ethanolicus |
| 47 | 2486859 | 2487149 | - | NZ_CP044331.1 | Methylocystis parvus |
| 48 | 2672258 | 2672548 | + | NZ_AP018437.1 | Pelolinea submarina |
| 49 | 1701077 | 1701367 | + | NC_014972.1 | Desulfobulbus propionicus DSM 2032 |
| 50 | 3947009 | 3947299 | + | NZ_CP033326.1 | Xanthomonas cucurbitae |
| 51 | 3888753 | 3889043 | - | NZ_CP036259.1 | Sporomusa termitida |
| 52 | 3334331 | 3334621 | + | NZ_CP027002.1 | [Ruminococcus] gnavus ATCC 29149 |
| 53 | 1762246 | 1762536 | + | NC_009633.1 | Alkaliphilus metalliredigens QYMF |
| 54 | 2193277 | 2193567 | + | NZ_CP054140.1 | Desulfobulbus oligotrophicus |
| 55 | 2764995 | 2765285 | - | NZ_LR699011.1 | Roseburia hominis |
| 56 | 2312544 | 2312834 | - | NC_013204.1 | Eggerthella lenta DSM 2243 |
| 57 | 405939 | 406229 | - | NZ_CP041217.1 | Saccharibacillus brassicae |
| 58 | 3519969 | 3520259 | + | NC_016633.1 | Sphaerochaeta pleomorpha str. Grapes |
| 59 | 4527935 | 4528225 | + | NZ_CP045298.1 | Paenibacillus brasilensis |
| 60 | 4332990 | 4333280 | + | NZ_CP028127.1 | Xanthomonas vasicola pv. vasculorum |
| 61 | 1478955 | 1479245 | + | NZ_CP043476.1 | Xanthomonas hyacinthi |
| 62 | 988887 | 989177 | + | NC_017584.1 | Rhodospirillum rubrum F11 |
| 63 | 894365 | 894670 | + | NC_015172.1 | Syntrophobotulus glycolicus DSM 8271 |
| 64 | 2479169 | 2479459 | + | NZ_CP014327.1 | Halocynthiibacter arcticus |
| 65 | 2519129 | 2519419 | + | NZ_CP020470.1 | Rhodobacter blasticus |
| 66 | 4369308 | 4369598 | - | NZ_CP007810.1 | Xanthomonas oryzae pv. oryzicola |
| 67 | 1449810 | 1450100 | - | NC_022997.1 | Hyphomicrobium nitrativorans NL23 |
| 68 | 1312755 | 1313045 | + | NC_014833.1 | Ruminococcus albus 7 = DSM 20455 |
| 69 | 2996636 | 2996926 | - | NZ_CP059082.1 | Halomonas titanicae |
| 70 | 31527 | 31817 | + | NZ_CP011971.1 | Steroidobacter denitrificans |
| 71 | 316456 | 316746 | + | NZ_CP041335.1 | Chitinolyticbacter meiyuanensis |
| 72 | 564264 | 564554 | + | NC_008346.1 | Syntrophomonas wolfei subsp. wolfei str. Goettingen G311 |
| 73 | 558166 | 558456 | + | NZ_LN879430.1 | Herbinix luporum |
| 74 | 863901 | 864191 | - | NC_011894.1 | Methylobacterium nodulans ORS 2060 |
| 75 | 89037 | 89327 | + | NZ_CP009302.1 | Berryella intestinalis |
| 76 | 1628968 | 1629258 | + | NZ_CP026538.1 | Desulfovibrio carbinolicus |
| 77 | 1079444 | 1079734 | + | NC_009253.1 | Desulfotomaculum reducens MI-1 |
| 78 | 838893 | 839183 | + | NC_008942.1 | Methanocorpusculum labreanum Z |
| 79 | 1368617 | 1368907 | + | NZ_CP010311.1 | Geoalkalibacter subterraneus |
| 80 | 2705251 | 2705541 | - | NZ_CP065748.1 | Delftia lacustris |
| 81 | 2746128 | 2746418 | - | NZ_CP017420.1 | Delftia tsuruhatensis |
| 82 | 1440963 | 1441253 | + | NZ_LR134506.1 | Porphyromonas cangingivalis |
| 83 | 1851893 | 1852183 | + | NZ_CP012908.1 | Ketogulonicigenium vulgare |
| 84 | 1062368 | 1062658 | + | NZ_CP045423.1 | Microvirga thermotolerans |
| 85 | 1786042 | 1786332 | - | NZ_AP021874.1 | Desulfosarcina alkanivorans |
| 86 | 2901985 | 2902275 | - | NZ_LN832559.1 | Paracoccus aminovorans |
| 87 | 4242047 | 4242337 | - | NC_021184.1 | Desulfoscipio gibsoniae DSM 7213 |
| 88 | 3933011 | 3933301 | - | NC_020304.1 | Desulfocapsa sulfexigens DSM 10523 |
| 89 | 1955105 | 1955395 | - | NZ_CP051774.1 | Luteolibacter luteus |
| 90 | 1761586 | 1761876 | + | NC_011060.1 | Pelodictyon phaeoclathratiforme BU-1 |
| 91 | 1298876 | 1299166 | - | NZ_CP009498.1 | Endomicrobium proavitum |
| 92 | 2614592 | 2614882 | + | NZ_CP029829.1 | Azospirillum ramasamyi |
| 93 | 2753165 | 2753455 | - | NC_007759.1 | Syntrophus aciditrophicus SB |
| 94 | 2512554 | 2512844 | + | NZ_CP048436.1 | Flavonifractor plautii |
| 95 | 881739 | 882029 | + | NC_013740.1 | Acidaminococcus fermentans DSM 20731 |
| 96 | 1292860 | 1293150 | + | NC_005085.1 | Chromobacterium violaceum ATCC 12472 |
| 97 | 2210749 | 2211039 | + | NZ_CP019791.1 | Anaerohalosphaera lusitana |
| 98 | 1844314 | 1844604 | + | NC_014365.1 | Desulfarculus baarsii DSM 2075 |
| 99 | 3118836 | 3119126 | + | NC_016147.2 | Pseudoxanthomonas spadix BD-a59 |
| 100 | 2846004 | 2846294 | - | NZ_CP015249.1 | Dokdonella koreensis DS-123 |
| 101 | 3698912 | 3699202 | + | NC_015677.1 | Ramlibacter tataouinensis TTB310 |
| 102 | 1633227 | 1633517 | - | NC_008639.1 | Chlorobium phaeobacteroides DSM 266 |
| 103 | 108845 | 109135 | - | NZ_CP012661.1 | Defluviimonas alba |
| 104 | 254100 | 254390 | + | NZ_CP034413.2 | Dysosmobacter welbionis |
| 105 | 3977372 | 3977662 | + | NZ_CP036278.1 | Aeoliella mucimassa |
| 106 | 2123744 | 2124034 | - | NC_007406.1 | Nitrobacter winogradskyi Nb-255 |
| 107 | 2584668 | 2584958 | - | NZ_CP021850.1 | Pseudoclostridium thermosuccinogenes |
| 108 | 1153735 | 1154025 | + | NZ_LS991421.1 | Lacticaseibacillus zeae |
| 109 | 2936781 | 2937071 | + | NZ_LR884459.1 | Psychrobacter arenosus |
| 110 | 772973 | 773263 | - | NC_017080.1 | Phycisphaera mikurensis NBRC 102666 |
| 111 | 1911282 | 1911572 | - | NZ_CP020612.1 | Paracoccus contaminans |
| 112 | 465367 | 465657 | + | NZ_CP016757.1 | Cloacibacillus porcorum |
| 113 | 1337536 | 1337826 | + | NZ_CP016757.1 | Cloacibacillus porcorum |
| 114 | 4426262 | 4426552 | + | NC_015138.1 | Acidovorax avenae subsp. avenae ATCC 19860 |
| 115 | 567522 | 567812 | + | NZ_AP021876.1 | Desulfosarcina ovata subsp. sediminis |
| 116 | 2648722 | 2649012 | - | NC_019943.1 | Methanoregula formicica SMSP |
| 117 | 1472725 | 1473015 | + | NC_007512.1 | Pelodictyon luteolum DSM 273 |
| 118 | 1605807 | 1606097 | - | NC_014220.1 | Syntrophothermus lipocalidus DSM 12680 |
| 119 | 2891048 | 2891338 | + | NZ_CP013341.1 | Nitrosomonas ureae |
| 120 | 4406927 | 4407214 | + | NC_008576.1 | Magnetococcus marinus MC-1 |
| 121 | 5088027 | 5088317 | - | NC_015174.1 | Rubinisphaera brasiliensis DSM 5305 |
| 122 | 4772697 | 4772987 | - | NC_015174.1 | Rubinisphaera brasiliensis DSM 5305 |
| 123 | 3240409 | 3240699 | + | NZ_CP028339.1 | Thauera aromatica K172 |
| 124 | 1548165 | 1548455 | - | NZ_CP018839.1 | Thauera chlorobenzoica |
| 125 | 1374155 | 1374445 | - | NZ_CP029462.1 | Megasphaera stantonii |
| 126 | 2920276 | 2920566 | - | NZ_CP007031.1 | Marichromatium purpuratum 984 |
| 127 | 1351772 | 1352062 | + | NC_014664.1 | Rhodomicrobium vannielii ATCC 17100 |
| 128 | 3546003 | 3546293 | - | NZ_CP039543.1 | Desulfovibrio marinus |
| 129 | 1841112 | 1841405 | - | NZ_CP033078.1 | Vibrio zhugei |
| 130 | 253277 | 253567 | + | NZ_HF545617.1 | Ruminococcus bicirculans |
| 131 | 2437452 | 2437742 | - | NC_016112.1 | Methylotuvimicrobium alcaliphilum 20Z |
| 132 | 1515994 | 1516284 | + | NC_016112.1 | Methylotuvimicrobium alcaliphilum 20Z |
| 133 | 2414976 | 2415266 | - | NZ_CP035467.1 | Methylotuvimicrobium buryatense |
| 134 | 6514137 | 6514427 | - | NZ_CP042912.1 | Mariniblastus fucicola |
| 135 | 7862438 | 7862725 | - | NZ_CP061800.1 | Desulfonema magnum |
| 136 | 1055243 | 1055533 | - | NC_002932.3 | Chlorobaculum tepidum TLS |
| 137 | 1151362 | 1151652 | + | NC_015501.1 | Porphyromonas asaccharolytica DSM 20707 |
| 138 | 2509877 | 2510167 | + | NZ_AP019781.1 | Methanoculleus chikugoensis |
| 139 | 6171364 | 6171654 | - | NZ_CP019082.1 | Paludisphaera borealis |
| 140 | 40962 | 41255 | + | NC_016630.1 | Filifactor alocis ATCC 35896 |
| 141 | 1228398 | 1228691 | + | NZ_CP045350.1 | Vibrio aquimaris |
| 142 | 6474781 | 6475071 | + | NZ_CP043930.1 | Gimesia benthica |
| 143 | 3369709 | 3369999 | + | NC_015572.1 | Methylomonas methanica MC09 |
| 144 | 2577243 | 2577530 | - | NC_015500.1 | Treponema brennaborense DSM 12168 |
| 145 | 2130498 | 2130788 | + | NZ_CP036291.1 | Pirellulimonas nuda |
| 146 | 4839861 | 4840154 | - | NZ_CP065640.1 | Serratia rubidaea |
| 147 | 911256 | 911546 | + | NC_018025.1 | Desulfomonile tiedjei DSM 6799 |
| 148 | 1678221 | 1678514 | - | NZ_CP031560.1 | Dickeya dianthicola |
| 149 | 420679 | 420969 | + | NZ_CP044117.1 | Roseomonas mucosa |
| 150 | 2917032 | 2917325 | + | NC_007645.1 | Hahella chejuensis KCTC 2396 |
| 151 | 2657597 | 2657887 | + | NZ_CP038033.1 | Nitrosococcus wardiae |
| 152 | 1533219 | 1533509 | - | NZ_LR134523.1 | Peptoniphilus ivorii |
| 153 | 96649 | 96942 | + | NZ_AP018722.1 | Thiomicrorhabdus aquaedulcis |
| 154 | 684633 | 684923 | - | NC_002977.6 | Methylococcus capsulatus str. Bath |
| 155 | 404933 | 405226 | + | NZ_CP034543.1 | Streptococcus periodonticum |
| 156 | 2009885 | 2010175 | + | NC_013960.1 | Nitrosococcus halophilus Nc 4 |
| 157 | 1730620 | 1730913 | - | NC_014500.1 | Dickeya dadantii 3937 |
| 158 | 582538 | 582831 | - | NZ_CP015031.1 | Basfia succiniciproducens |
| 159 | 957194 | 957487 | - | NC_006300.1 | [Mannheimia] succiniciproducens MBEL55E |
| 160 | 2802455 | 2802748 | - | NC_010995.1 | Cellvibrio japonicus Ueda107 |
| 161 | 781895 | 782188 | - | NZ_LR134341.1 | Streptococcus pseudoporcinus |
| 162 | 406045 | 406335 | - | NZ_CP017237.1 | Moorella thermoacetica |
| 163 | 1172939 | 1173232 | + | NZ_LR134293.1 | Streptococcus canis |
| 164 | 1639070 | 1639363 | + | NZ_CP031325.1 | Neisseria polysaccharea |
| 165 | 3491180 | 3491473 | + | NC_016803.1 | Pseudodesulfovibrio mercurii |
| 166 | 35541 | 35831 | - | NZ_CP069440.1 | Phocaeicola coprophilus |
| 167 | 2351468 | 2351761 | - | NC_020888.1 | Thalassolituus oleivorans MIL-1 |
| 168 | 1474989 | 1475282 | - | NZ_CP065061.1 | Streptococcus equi subsp. zooepidemicus |
| 169 | 394321 | 394614 | + | NZ_CP031253.1 | Neisseria lactamica |
| 170 | 1355102 | 1355395 | - | NZ_LT906439.1 | Streptococcus merionis |
| 171 | 545980 | 546273 | - | NZ_CP046400.1 | Pseudodesulfovibrio cashew |
| 172 | 418604 | 418894 | - | NC_017958.1 | Tistrella mobilis KA081020-065 |
| 173 | 1014062 | 1014355 | - | NZ_CP014835.1 | Streptococcus halotolerans |
| 174 | 1680364 | 1680654 | + | NZ_CP021255.1 | Desulfobulbus oralis |
| 175 | 506470 | 506763 | + | NZ_CP012047.1 | Tetragenococcus halophilus |
| 176 | 1639789 | 1640082 | + | NZ_CP046027.1 | Neisseria brasiliensis |
| 177 | 834285 | 834575 | + | NZ_CP011381.2 | Moraxella bovoculi |
| 178 | 903483 | 903773 | + | NZ_CP011158.1 | Moraxella ovis |
| 179 | 1723832 | 1724125 | + | NZ_CP055305.1 | Mannheimia pernigra |
| 180 | 1591945 | 1592238 | - | NZ_LR134524.1 | Peptoniphilus harei |
| 181 | 571777 | 572067 | - | NZ_LR699004.1 | Phocaeicola dorei |
| 182 | 709146 | 709439 | - | NZ_LR134365.1 | Cardiobacterium hominis |
| 183 | 1098091 | 1098381 | - | NZ_CP025612.1 | Niveispirillum cyanobacteriorum |
| 184 | 632123 | 632416 | + | NC_007947.1 | Methylobacillus flagellatus KT |
| 185 | 1786551 | 1786841 | - | NZ_CP030265.1 | Skermanella pratensis |
| 186 | 1158940 | 1159233 | + | NZ_CP029206.1 | Actinobacillus porcitonsillarum |
| 187 | 1390835 | 1391068 | + | NZ_CP018058.1 | Geobacillus thermocatenulatus |
| 188 | 3266532 | 3266819 | - | NC_012560.1 | Azotobacter vinelandii DJ |
| 189 | 581320 | 581613 | + | NZ_CP039887.1 | Neisseria subflava |
| 190 | 1096743 | 1097036 | - | NZ_CP072524.1 | Neisseria sicca |
| 191 | 1936631 | 1936924 | - | NZ_CP022278.1 | Neisseria chenwenguii |
| 192 | 233725 | 234018 | + | NZ_CP031252.1 | Neisseria elongata |
| 193 | 667675 | 667968 | - | NZ_LR134327.1 | Aggregatibacter aphrophilus ATCC 33389 |
| 194 | 1474197 | 1474490 | - | NZ_CP059567.1 | Neisseria shayeganii |
| 195 | 188995 | 189288 | - | NZ_LT906434.1 | Neisseria zoodegmatis |
| 196 | 1889746 | 1890039 | - | NZ_LR134516.1 | Neisseria animaloris |
| 197 | 526457 | 526750 | + | NZ_CP039886.1 | Neisseria flavescens |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_002570.2
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF09704.12 | 0.76 | 147 | 4438.5 | same-strand | CRISPR-associated protein (Cas Cas5) |
| 2 | PF09709.12 | 0.9 | 174 | 2607.0 | same-strand | CRISPR-associated protein (Cas Csd1) |
| 3 | PF05107.14 | 0.96 | 185 | 1709.0 | same-strand | CRISPR-associated protein Cas7 |
| 4 | PF01930.19 | 0.95 | 183 | 1040.5 | same-strand | Domain of unknown function DUF83 |
| 5 | PF01867.18 | 0.98 | 189 | 11.0 | same-strand | CRISPR associated protein Cas1 |
++ More..