Result : Q9KB63
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Spore morphogenesis and germination protein YwcE |
| NCBI Accession ID | BA000004.3 |
| Organism | Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) |
| Left | 2189064 |
| Right | 2189345 |
| Strand | - |
| Nucleotide Sequence | ATGGATTTGTTTTTTGCTTATATGCTAGTTGCAAGCGCCACACCATTATTTTTGTGGCTTGAACATCGAAAAATAGCGTTAACGAGTATCCCGTTTATTATTATCATGTGGGTGTTGGCTTTAAGTCACATGTTTGAAGGGTTTTTATTTGACCTTCATCACTCCGTTTTTCTTACGGCCTTTTTTGTAAACGTTATTATTGCCCATTTTGCGGCTCTTGTATTGTATGCATATCCGCACATTCGTCCAAAATCTCGCACATTCACGGAATCAATGGACTAG |
| Sequence | MDLFFAYMLVASATPLFLWLEHRKIALTSIPFIIIMWVLALSHMFEGFLFDLHHSVFLTAFFVNVIIAHFAALVLYAYPHIRPKSRTFTESMD |
| Source of smORF | Swiss-Prot |
| Function | Required for proper spore morphogenesis. Important for spore germination (By similarity). {ECO:0000250}. |
| Pubmed ID | 11058132 |
| Domain | CDD:407457 |
| Functional Category | Others |
| Uniprot ID | Q9KB63 |
| ORF Length (Amino Acid) | 93 |
++ More..
| Conservation Analysis |
No. of Species: 16
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2189064 | 2189345 | - | NC_002570.2 | Alkalihalobacillus halodurans C-125 |
| 2 | 4285139 | 4285399 | + | NZ_LT603683.1 | Bacillus glycinifermentans |
| 3 | 3739074 | 3739334 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 4 | 3799477 | 3799737 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 5 | 3914012 | 3914272 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 6 | 3736116 | 3736376 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 7 | 4059179 | 4059439 | + | NZ_CP023665.1 | Bacillus paralicheniformis |
| 8 | 3853866 | 3854126 | + | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 9 | 3726439 | 3726702 | + | NZ_CP051464.1 | Bacillus mojavensis |
| 10 | 3775860 | 3776123 | + | NZ_CP033052.1 | Bacillus vallismortis |
| 11 | 2324986 | 2325249 | - | NZ_CP029364.1 | Bacillus halotolerans |
| 12 | 1905619 | 1905882 | - | NZ_CP017786.1 | Bacillus xiamenensis |
| 13 | 3456242 | 3456505 | + | NZ_CP011150.1 | Bacillus altitudinis |
| 14 | 1834425 | 1834688 | - | NZ_CP043404.1 | Bacillus safensis |
| 15 | 275222 | 275482 | - | NZ_CP011937.1 | Bacillus velezensis |
| 16 | 3766656 | 3766916 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP013984.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00115.22 | 0.88 | 14 | 1061.0 | opposite-strand | Cytochrome C and Quinol oxidase polypeptide I |
| 2 | PF03626.16 | 0.88 | 14 | 45.0 | opposite-strand | Prokaryotic Cytochrome C oxidase subunit IV |
| 3 | PF00881.26 | 0.88 | 14 | 1817.0 | opposite-strand | Nitroreductase family |
| 4 | PF01098.21 | 0.94 | 15 | 953.5 | opposite-strand | Cell cycle protein |
| 5 | PF00082.24 | 0.69 | 11 | 3925 | same-strand | Subtilase family |
| 6 | PF02225.24 | 0.69 | 11 | 3925 | same-strand | PA domain |
| 7 | PF05922.18 | 0.69 | 11 | 3925 | same-strand | Peptidase inhibitor I9 |
| 8 | PF00296.22 | 0.69 | 11 | 2720 | opposite-strand | Luciferase-like monooxygenase |
++ More..