Result : Q9KAK0
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Small, acid-soluble spore protein Tlp |
| NCBI Accession ID | BA000004.3 |
| Organism | Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) |
| Left | 2409142 |
| Right | 2409372 |
| Strand | - |
| Nucleotide Sequence | ATGGCAAACCCTGATAATCGTAACAACAATGTTGAGCGGCTGAAACAAATGGTTCGCAATACGAAGGCGAAGATGGAAGCAGCAAACGAAGCGCTCGCCCATGAAGAGATGAACGCTGAAGAGCGCCAGCGGACAGAAGAAAAAAACAACCGGCGTAAGCAAAGCTTAGACGCTTTTGAATCAGAAATTTTAGATGAGCAAAGTGCACGAATCAATGACGATGAAGTCTAA |
| Sequence | MANPDNRNNNVERLKQMVRNTKAKMEAANEALAHEEMNAEERQRTEEKNNRRKQSLDAFESEILDEQSARINDDEV |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl07951. Profile Description: N/A. This protein family is restricted to a subset of endospore-forming bacteria such as Bacillus subtilis, all of which are in the Firmicutes (low-GC Gram-positive) lineage. Although previously designated tlp (thioredoxin-like protein), the B. subtilis protein was shown to be a minor small acid-soluble spore protein SASP, unique to spores. The motif E[VIL]XDE near the C-terminus probably represents at a germination protease cleavage site. [Cellular processes, Sporulation and germination] |
| Pubmed ID | 11058132 |
| Domain | CDD:186720 |
| Functional Category | Others |
| Uniprot ID | Q9KAK0 |
| ORF Length (Amino Acid) | 76 |
++ More..
| Conservation Analysis |
No. of Species: 6
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2409142 | 2409372 | - | NC_002570.2 | Alkalihalobacillus halodurans C-125 |
| 2 | 2171636 | 2171866 | - | NC_013791.2 | Alkalihalobacillus pseudofirmus OF4 |
| 3 | 2341510 | 2341737 | + | NC_014829.1 | Evansella cellulosilytica DSM 2522 |
| 4 | 3752187 | 3752414 | + | NZ_CP063356.1 | Anaerobacillus isosaccharinicus |
| 5 | 1879486 | 1879728 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 6 | 4622241 | 4622483 | - | NZ_CP041305.1 | Cytobacillus ciccensis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_002570.2
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02540.19 | 0.67 | 4 | 552.0 | same-strand | NAD synthase |
| 2 | PF03061.24 | 1.0 | 6 | 82.5 | same-strand | Thioesterase superfamily |
| 3 | PF13279.8 | 1.0 | 6 | 82.5 | same-strand | Thioesterase-like superfamily |
| 4 | PF00004.31 | 0.83 | 5 | 494 | same-strand | ATPase family associated with various cellular activities (AAA) |
| 5 | PF17866.3 | 0.83 | 5 | 494 | same-strand | AAA lid domain |
++ More..