Protein name |
Small, acid-soluble spore protein Tlp |
NCBI Accession ID |
BA000004.3 |
Organism |
Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) |
Left |
2409142 |
Right |
2409372 |
Strand |
- |
Nucleotide Sequence |
ATGGCAAACCCTGATAATCGTAACAACAATGTTGAGCGGCTGAAACAAATGGTTCGCAATACGAAGGCGAAGATGGAAGCAGCAAACGAAGCGCTCGCCCATGAAGAGATGAACGCTGAAGAGCGCCAGCGGACAGAAGAAAAAAACAACCGGCGTAAGCAAAGCTTAGACGCTTTTGAATCAGAAATTTTAGATGAGCAAAGTGCACGAATCAATGACGATGAAGTCTAA |
Sequence |
MANPDNRNNNVERLKQMVRNTKAKMEAANEALAHEEMNAEERQRTEEKNNRRKQSLDAFESEILDEQSARINDDEV |
Source of smORF |
Swiss-Prot |
Function |
The ORF matches to the profile of cl07951. Profile Description: N/A. This protein family is restricted to a subset of endospore-forming bacteria such as Bacillus subtilis, all of which are in the Firmicutes (low-GC Gram-positive) lineage. Although previously designated tlp (thioredoxin-like protein), the B. subtilis protein was shown to be a minor small acid-soluble spore protein SASP, unique to spores. The motif E[VIL]XDE near the C-terminus probably represents at a germination protease cleavage site. [Cellular processes, Sporulation and germination] |
Pubmed ID |
11058132
|
Domain |
CDD:186720 |
Functional Category |
Others |
Uniprot ID |
Q9KAK0
|
ORF Length (Amino Acid) |
76 |