Result : Q9KAJ2
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Small, acid-soluble spore protein N (SASP N) |
| NCBI Accession ID | BA000004.3 |
| Organism | Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) |
| Left | 2417358 |
| Right | 2417498 |
| Strand | - |
| Nucleotide Sequence | ATGGCGAAGATGAAACATGGTTCTGCCCAGTTTCGCCCAGATCACTTAGGAACCCAGCCGAGAAAGTCAGATGCCAATAAAGGGAAAAAGATGAACACAAAAGGGAATGAGAACCCCCAATACATCCCTCCGAAAGGTTGA |
| Sequence | MAKMKHGSAQFRPDHLGTQPRKSDANKGKKMNTKGNENPQYIPPKG |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl27883. Profile Description: Small acid-soluble spore protein N family. acid-soluble spore protein N; Provisional |
| Pubmed ID | 11058132 |
| Domain | CDD:332704 |
| Functional Category | Others |
| Uniprot ID | Q9KAJ2 |
| ORF Length (Amino Acid) | 46 |
++ More..
| Conservation Analysis |
No. of Species: 15
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2417358 | 2417498 | - | NC_002570.2 | Alkalihalobacillus halodurans C-125 |
| 2 | 3741084 | 3741224 | + | NZ_CP063356.1 | Anaerobacillus isosaccharinicus |
| 3 | 2333256 | 2333399 | + | NC_014829.1 | Evansella cellulosilytica DSM 2522 |
| 4 | 2179441 | 2179578 | - | NC_013791.2 | Alkalihalobacillus pseudofirmus OF4 |
| 5 | 1870838 | 1870981 | + | NZ_CP029797.1 | Paraliobacillus zengyii |
| 6 | 3545966 | 3546109 | - | NZ_CP017786.1 | Bacillus xiamenensis |
| 7 | 1779702 | 1779845 | + | NZ_CP011150.1 | Bacillus altitudinis |
| 8 | 3535948 | 3536091 | - | NZ_CP043404.1 | Bacillus safensis |
| 9 | 1687942 | 1688085 | - | NZ_CP012024.1 | Bacillus smithii |
| 10 | 3059017 | 3059160 | - | NZ_CP017703.1 | Aeribacillus pallidus |
| 11 | 153086 | 153229 | - | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 12 | 374881 | 375024 | + | NZ_CP009709.1 | Weizmannia coagulans DSM 1 = ATCC 7050 |
| 13 | 4999856 | 4999999 | + | NZ_CP030926.1 | Peribacillus butanolivorans |
| 14 | 2043237 | 2043383 | + | NZ_CP033052.1 | Bacillus vallismortis |
| 15 | 2172777 | 2172920 | + | NZ_LT603683.1 | Bacillus glycinifermentans |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP017786.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF13040.8 | 1.0 | 15 | 67 | same-strand | Fur-regulated basic protein B |
| 2 | PF00330.22 | 0.8 | 12 | 851.0 | same-strand | Aconitase family (aconitate hydratase) |
| 3 | PF00694.21 | 0.8 | 12 | 851.0 | same-strand | Aconitase C-terminal domain |
| 4 | PF19824.1 | 0.73 | 11 | 28 | same-strand | Small, acid-soluble spore protein Tlp |
| 5 | PF03061.24 | 0.67 | 10 | 422.0 | same-strand | Thioesterase superfamily |
| 6 | PF13279.8 | 0.67 | 10 | 422.0 | same-strand | Thioesterase-like superfamily |
| 7 | PF00578.23 | 0.6 | 9 | 269 | same-strand | AhpC/TSA family |
| 8 | PF08534.12 | 0.6 | 9 | 269 | same-strand | Redoxin |
| 9 | PF13905.8 | 0.6 | 9 | 269 | same-strand | Thioredoxin-like |
| 10 | PF13098.8 | 0.6 | 9 | 269 | same-strand | Thioredoxin-like domain |
++ More..