Protein Information |
Information Type | Description |
---|---|
Protein name | Small, acid-soluble spore protein O (SASP O) |
NCBI Accession ID | BA000004.3 |
Organism | Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) |
Left | 2421779 |
Right | 2421940 |
Strand | + |
Nucleotide Sequence | ATGGTACGTAAAAAAGCAAACCATTCCCGTCCTGGAATGAACGCAGCTAAAGCTCAAGGGAAGGATGCGGGCTTAACATCTCAATTTCACGCGGAAATAGGACAAGAGCCGCTCAATCAAGCTCAGAGGCAAAACAATAAAAAGCGAAAAAAGAACCAATAG |
Sequence | MVRKKANHSRPGMNAAKAQGKDAGLTSQFHAEIGQEPLNQAQRQNNKKRKKNQ |
Source of smORF | Swiss-Prot |
Function | The ORF matches to the profile of cl07943. Profile Description: Small acid-soluble spore protein O family. This model represents a minor (low-abundance) spore protein, designated SspO. It is found in a very limited subset of the already small group of endospore-forming bacteria, but these species include Oceanobacillus iheyensis, Geobacillus kaustophilus, Bacillus subtilis, B. halodurans, and B. cereus. This protein was previously called CotK. [Cellular processes, Sporulation and germination] |
Pubmed ID | 11058132 |
Domain | CDD:385277 |
Functional Category | Others |
Uniprot ID | Q9KAI7 |
ORF Length (Amino Acid) | 53 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 2421779 | 2421940 | + | NC_002570.2 | Alkalihalobacillus halodurans C-125 |
2 | 371440 | 371589 | - | NZ_CP009709.1 | Weizmannia coagulans DSM 1 = ATCC 7050 |
3 | 1806843 | 1807013 | - | NZ_CP015378.1 | Fictibacillus phosphorivorans |
4 | 2188343 | 2188504 | + | NC_013791.2 | Alkalihalobacillus pseudofirmus OF4 |
5 | 43935 | 44081 | + | NZ_CP029364.1 | Bacillus halotolerans |
6 | 1853517 | 1853663 | - | NZ_CP051464.1 | Bacillus mojavensis |
7 | 1888389 | 1888535 | - | NZ_CP048852.1 | Bacillus tequilensis |
8 | 1890194 | 1890340 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
9 | 1834621 | 1834767 | - | NZ_CP013984.1 | Bacillus inaquosorum |
10 | 1926306 | 1926452 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
11 | 2080313 | 2080459 | + | NZ_CP011937.1 | Bacillus velezensis |
12 | 2039283 | 2039429 | - | NZ_CP033052.1 | Bacillus vallismortis |
13 | 1875374 | 1875520 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
14 | 2168821 | 2168967 | - | NZ_LT603683.1 | Bacillus glycinifermentans |
15 | 2036241 | 2036387 | - | NZ_CP023665.1 | Bacillus paralicheniformis |
16 | 1985655 | 1985801 | - | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
17 | 2615709 | 2615858 | + | NZ_CP018058.1 | Geobacillus thermocatenulatus |
18 | 2284891 | 2285040 | - | NZ_CP042593.1 | Bacillus dafuensis |
19 | 796458 | 796607 | - | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
20 | 1576689 | 1576838 | - | NZ_CP015438.1 | Anoxybacillus amylolyticus |
21 | 2359644 | 2359793 | + | NZ_CP024109.1 | Bacillus cytotoxicus |
22 | 3644886 | 3645035 | + | NC_011725.1 | Bacillus cereus B4264 |
23 | 4626896 | 4627048 | + | NZ_CP041305.1 | Cytobacillus ciccensis |
24 | 3561788 | 3561937 | + | NZ_CP032365.1 | Bacillus wiedmannii |
25 | 2172565 | 2172714 | + | NZ_CP016020.1 | Bacillus weihaiensis |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF08177.13 | 0.72 | 18 | 3808.5 | opposite-strand | Small acid-soluble spore protein N family |
2 | PF13040.8 | 0.68 | 17 | 3618 | opposite-strand | Fur-regulated basic protein B |
3 | PF00330.22 | 1.0 | 25 | 235 | opposite-strand | Aconitase family (aconitate hydratase) |
4 | PF00694.21 | 1.0 | 25 | 235 | opposite-strand | Aconitase C-terminal domain |
5 | PF08179.14 | 0.84 | 21 | 32 | same-strand | Small acid-soluble spore protein P family |
6 | PF00578.23 | 0.72 | 18 | 3030.5 | opposite-strand | AhpC/TSA family |
7 | PF08534.12 | 0.72 | 18 | 3030.5 | opposite-strand | Redoxin |
8 | PF13905.8 | 0.72 | 18 | 3030.5 | opposite-strand | Thioredoxin-like |
9 | PF13098.8 | 0.72 | 18 | 3030.5 | opposite-strand | Thioredoxin-like domain |