Result : Q9KAD6
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | UPF0291 protein BH2353 |
| NCBI Accession ID | BA000004.3 |
| Organism | Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) |
| Left | 2471186 |
| Right | 2471425 |
| Strand | - |
| Nucleotide Sequence | ATGCTTTCTAAGCAAAAAATCGAACGGATCAATGAACTAGCAAAGCGAGCAAAAACAACAGGTCTGACAGAGGATGAGCTTCGCGAGCAAAAAAAATTACGTGAAGAATACATTCAACAATTTCGTCAGTCCTTTAAAAATCAACTACATTCGGTAACGGTCGTCGATGGAGCAGGAAATGACGTAACACCAGATAAATTAAAACAAAGCAAAAATAAGTACCGCAACGACATTCACTAA |
| Sequence | MLSKQKIERINELAKRAKTTGLTEDELREQKKLREEYIQQFRQSFKNQLHSVTVVDGAGNDVTPDKLKQSKNKYRNDIH |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl01722. Profile Description: Bacterial protein of unknown function (DUF896). hypothetical protein; Provisional |
| Pubmed ID | 11058132 |
| Domain | CDD:413030 |
| Functional Category | Others |
| Uniprot ID | Q9KAD6 |
| ORF Length (Amino Acid) | 79 |
++ More..
| Conservation Analysis |
No. of Species: 148
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2471186 | 2471425 | - | NC_002570.2 | Alkalihalobacillus halodurans C-125 |
| 2 | 2216602 | 2216844 | - | NC_013791.2 | Alkalihalobacillus pseudofirmus OF4 |
| 3 | 1962885 | 1963115 | + | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
| 4 | 498169 | 498402 | - | NZ_CP031092.1 | Salicibibacter kimchii |
| 5 | 437574 | 437807 | - | NZ_CP035485.1 | Salicibibacter halophilus |
| 6 | 2635915 | 2636145 | - | NZ_CP070511.1 | Parageobacillus toebii |
| 7 | 2013264 | 2013494 | - | NZ_CP014342.1 | Geobacillus subterraneus |
| 8 | 1355318 | 1355548 | + | NC_006510.1 | Geobacillus kaustophilus HTA426 |
| 9 | 805049 | 805279 | + | NZ_CP061472.1 | Geobacillus thermoleovorans |
| 10 | 3532763 | 3533005 | + | NZ_CP063356.1 | Anaerobacillus isosaccharinicus |
| 11 | 1565685 | 1565915 | + | NZ_CP015438.1 | Anoxybacillus amylolyticus |
| 12 | 2627464 | 2627694 | - | NZ_CP018058.1 | Geobacillus thermocatenulatus |
| 13 | 445550 | 445780 | + | NZ_CP061470.1 | Geobacillus zalihae |
| 14 | 16311 | 16541 | - | NZ_CP022983.1 | Cytobacillus kochii |
| 15 | 777328 | 777558 | + | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
| 16 | 1978744 | 1978977 | + | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 17 | 1172675 | 1172908 | + | NZ_CP040676.1 | Exiguobacterium mexicanum |
| 18 | 3070188 | 3070418 | - | NZ_CP017703.1 | Aeribacillus pallidus |
| 19 | 2346422 | 2346658 | + | NZ_CP020773.1 | Staphylococcus lutrae |
| 20 | 2593123 | 2593362 | - | NC_014829.1 | Evansella cellulosilytica DSM 2522 |
| 21 | 2029330 | 2029563 | + | NZ_CP023665.1 | Bacillus paralicheniformis |
| 22 | 1785373 | 1785612 | + | NZ_CP015378.1 | Fictibacillus phosphorivorans |
| 23 | 1675750 | 1675983 | - | NZ_CP038012.1 | Sporosarcina pasteurii |
| 24 | 2449028 | 2449258 | - | NZ_CP018866.1 | Sutcliffiella cohnii |
| 25 | 545196 | 545429 | - | NZ_CP009709.1 | Weizmannia coagulans DSM 1 = ATCC 7050 |
| 26 | 2203257 | 2203490 | + | NZ_CP042593.1 | Bacillus dafuensis |
| 27 | 2161956 | 2162189 | + | NZ_LT603683.1 | Bacillus glycinifermentans |
| 28 | 1405969 | 1406202 | - | NC_018704.1 | Amphibacillus xylanus NBRC 15112 |
| 29 | 2087038 | 2087271 | - | NZ_CP011937.1 | Bacillus velezensis |
| 30 | 1868563 | 1868796 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 31 | 4787194 | 4787424 | - | NZ_CP041305.1 | Cytobacillus ciccensis |
| 32 | 50702 | 50935 | - | NZ_CP029364.1 | Bacillus halotolerans |
| 33 | 3737044 | 3737277 | - | NZ_CP018622.1 | Virgibacillus dokdonensis |
| 34 | 1979326 | 1979559 | - | NZ_CP017962.1 | Virgibacillus halodenitrificans |
| 35 | 2427868 | 2428101 | - | NZ_CP022437.1 | Virgibacillus necropolis |
| 36 | 3546453 | 3546683 | - | NZ_CP043404.1 | Bacillus safensis |
| 37 | 2427487 | 2427720 | - | NZ_CP017560.1 | Sporosarcina ureilytica |
| 38 | 1816353 | 1816589 | + | NZ_CP027770.1 | Staphylococcus felis |
| 39 | 1948371 | 1948604 | - | NZ_CP038015.1 | Paenisporosarcina antarctica |
| 40 | 597020 | 597256 | - | NZ_CP065729.1 | Macrococcus caseolyticus |
| 41 | 1324143 | 1324379 | - | NZ_CP022046.2 | Mammaliicoccus sciuri |
| 42 | 1284394 | 1284627 | + | NZ_CP006837.1 | Lysinibacillus varians |
| 43 | 3373136 | 3373369 | - | NZ_CP019980.1 | Lysinibacillus sphaericus |
| 44 | 1129822 | 1130058 | + | NC_014925.1 | Staphylococcus pseudintermedius HKU10-03 |
| 45 | 1056438 | 1056674 | - | NZ_CP068053.1 | Peribacillus psychrosaccharolyticus |
| 46 | 988159 | 988395 | + | NZ_CP045927.1 | Staphylococcus agnetis |
| 47 | 1906722 | 1906955 | + | NZ_CP024848.1 | Oceanobacillus zhaokaii |
| 48 | 1609373 | 1609606 | + | NZ_CP031223.1 | Psychrobacillus glaciei |
| 49 | 3140957 | 3141193 | + | NZ_CP015108.1 | Sporosarcina ureae |
| 50 | 2430475 | 2430708 | - | NZ_CP065425.1 | Heyndrickxia vini |
| 51 | 1871600 | 1871833 | - | NZ_CP016539.2 | Planococcus plakortidis |
| 52 | 1893954 | 1894187 | - | NZ_CP016538.2 | Planococcus maritimus |
| 53 | 1917829 | 1918062 | - | NZ_CP059540.1 | Planococcus maritimus |
| 54 | 655671 | 655904 | - | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 55 | 2032444 | 2032677 | + | NZ_CP033052.1 | Bacillus vallismortis |
| 56 | 1712352 | 1712585 | + | NC_004193.1 | Oceanobacillus iheyensis HTE831 |
| 57 | 2206524 | 2206754 | - | NZ_CP016020.1 | Bacillus weihaiensis |
| 58 | 1115215 | 1115451 | + | NZ_CP047361.1 | Macrococcus canis |
| 59 | 1846666 | 1846899 | + | NZ_CP051464.1 | Bacillus mojavensis |
| 60 | 2169848 | 2170090 | + | NZ_CP049887.1 | Vagococcus hydrophili |
| 61 | 2329784 | 2330017 | - | NZ_CP020772.1 | Halobacillus mangrovi |
| 62 | 1869902 | 1870141 | - | NZ_CP012502.1 | Bacillus beveridgei |
| 63 | 1769111 | 1769341 | + | NZ_CP011150.1 | Bacillus altitudinis |
| 64 | 839398 | 839634 | + | NZ_CP068061.1 | Mammaliicoccus vitulinus |
| 65 | 2070226 | 2070468 | - | NZ_CP060720.1 | Vagococcus carniphilus |
| 66 | 1648980 | 1649213 | - | NZ_CP013659.2 | Planococcus rifietoensis |
| 67 | 1684599 | 1684835 | + | NZ_CP041666.1 | Radiobacillus deserti |
| 68 | 1568580 | 1568816 | - | NZ_CP008747.1 | Staphylococcus hyicus |
| 69 | 4521481 | 4521714 | + | NZ_CP030926.1 | Peribacillus butanolivorans |
| 70 | 817375 | 817608 | + | NZ_CP013862.1 | Lentibacillus amyloliquefaciens |
| 71 | 1521186 | 1521443 | - | NZ_CP064056.1 | Staphylococcus lloydii |
| 72 | 1147782 | 1148018 | + | NC_010556.1 | Exiguobacterium sibiricum 255-15 |
| 73 | 1409501 | 1409737 | - | NZ_LT906462.1 | Mammaliicoccus stepanovicii |
| 74 | 3163002 | 3163235 | - | NZ_CP014616.1 | Sporosarcina psychrophila |
| 75 | 1827776 | 1828009 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 76 | 1919459 | 1919692 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 77 | 1839740 | 1839973 | + | NZ_CP023704.1 | Caldibacillus thermoamylovorans |
| 78 | 1908787 | 1909026 | + | NC_022524.1 | Bacillus infantis NRRL B-14911 |
| 79 | 1883347 | 1883580 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 80 | 1673231 | 1673464 | + | NZ_CP009416.1 | Jeotgalibacillus malaysiensis |
| 81 | 3183372 | 3183608 | - | NZ_CP022315.1 | Virgibacillus phasianinus |
| 82 | 1299218 | 1299454 | - | NZ_LT906464.1 | Staphylococcus muscae |
| 83 | 2206410 | 2206649 | - | NZ_CP033732.1 | Staphylococcus hominis |
| 84 | 3556459 | 3556689 | - | NZ_CP017786.1 | Bacillus xiamenensis |
| 85 | 3575487 | 3575720 | - | NZ_CP010820.1 | Lysinibacillus fusiformis |
| 86 | 2032270 | 2032503 | - | NZ_CP016540.2 | Planococcus versutus |
| 87 | 2131742 | 2131975 | + | NC_017668.1 | Halobacillus halophilus DSM 2266 |
| 88 | 3856031 | 3856261 | - | NZ_CP024035.1 | Priestia aryabhattai |
| 89 | 1398604 | 1398828 | + | NZ_CP008876.1 | Terribacillus goriensis |
| 90 | 2165805 | 2166059 | - | NZ_CP023011.2 | Enterococcus hirae |
| 91 | 1881541 | 1881774 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 92 | 1862302 | 1862526 | + | NZ_CP029797.1 | Paraliobacillus zengyii |
| 93 | 1413641 | 1413883 | - | NZ_AP022822.1 | Enterococcus saigonensis |
| 94 | 1214689 | 1214928 | - | NZ_CP049886.1 | Vagococcus coleopterorum |
| 95 | 1219267 | 1219518 | + | NZ_CP018061.1 | Enterococcus mundtii |
| 96 | 1410031 | 1410270 | + | NZ_CP016843.1 | Carnobacterium divergens |
| 97 | 1002552 | 1002785 | + | NZ_CP013911.1 | Staphylococcus haemolyticus |
| 98 | 603558 | 603800 | + | NZ_CP021874.1 | Enterococcus wangshanyuanii |
| 99 | 1231911 | 1232147 | + | NZ_CP054482.1 | Macrococcus bohemicus |
| 100 | 1312850 | 1313074 | + | NZ_LT906460.1 | Staphylococcus simiae |
| 101 | 1546355 | 1546594 | - | NZ_CP023074.1 | Enterococcus thailandicus |
| 102 | 1723166 | 1723399 | - | NZ_CP012024.1 | Bacillus smithii |
| 103 | 1811297 | 1811536 | - | NC_020995.1 | Enterococcus casseliflavus EC20 |
| 104 | 1821405 | 1821656 | + | NZ_CP053988.1 | Abiotrophia defectiva |
| 105 | 1141462 | 1141701 | + | NZ_LS483306.1 | Enterococcus cecorum |
| 106 | 902719 | 902970 | + | NZ_CP039712.1 | Vagococcus zengguangii |
| 107 | 1415895 | 1416125 | + | NZ_AP024085.1 | Faecalibacillus intestinalis |
| 108 | 2407442 | 2407675 | - | NZ_LS483476.1 | Lederbergia lentus |
| 109 | 3452850 | 3453089 | - | NC_007530.2 | Bacillus anthracis str. 'Ames Ancestor' |
| 110 | 671771 | 672013 | + | NZ_CP017267.1 | Vagococcus teuberi |
| 111 | 1584897 | 1585145 | - | NZ_CP008724.1 | Staphylococcus xylosus |
| 112 | 1276208 | 1276432 | + | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
| 113 | 1304115 | 1304345 | + | NZ_CP012152.1 | Anoxybacillus gonensis |
| 114 | 1900892 | 1901134 | + | NZ_CP027783.1 | Tetragenococcus osmophilus |
| 115 | 1104628 | 1104882 | + | NZ_CP043405.1 | Streptococcus ratti |
| 116 | 1377389 | 1377613 | + | NZ_LR134304.1 | Staphylococcus schweitzeri |
| 117 | 1309984 | 1310211 | + | NZ_LT906444.1 | Listeria welshimeri |
| 118 | 1786349 | 1786603 | - | NZ_LT906439.1 | Streptococcus merionis |
| 119 | 1970186 | 1970443 | - | NZ_CP031733.1 | Streptococcus chenjunshii |
| 120 | 1434475 | 1434717 | + | NZ_CP033460.1 | Staphylococcus debuckii |
| 121 | 3495314 | 3495553 | - | NZ_CP064875.1 | Bacillus toyonensis |
| 122 | 1634600 | 1634800 | - | NZ_CP031700.1 | Neisseria zalophi |
| 123 | 1344322 | 1344555 | - | NZ_CP011361.2 | Salimicrobium jeotgali |
| 124 | 1241512 | 1241739 | + | NC_013891.1 | Listeria seeligeri serovar 1/2b str. SLCC3954 |
| 125 | 3627343 | 3627582 | - | NZ_CP032365.1 | Bacillus wiedmannii |
| 126 | 1684568 | 1684807 | + | NZ_CP040336.1 | Bacillus luti |
| 127 | 3707817 | 3708056 | - | NC_011725.1 | Bacillus cereus B4264 |
| 128 | 446054 | 446275 | - | NZ_CP014022.1 | Staphylococcus lugdunensis |
| 129 | 1331439 | 1331666 | + | NC_003210.1 | Listeria monocytogenes EGD-e |
| 130 | 1076170 | 1076400 | + | NZ_CP068170.1 | Erysipelatoclostridium ramosum |
| 131 | 1357830 | 1358057 | + | NZ_CP009577.1 | Listeria ivanovii subsp. ivanovii |
| 132 | 457052 | 457285 | + | NZ_CP015029.1 | Frederiksenia canicola |
| 133 | 749970 | 750164 | + | NZ_CP043026.1 | Spiroplasma chinense |
| 134 | 4023761 | 4023976 | + | NZ_CP054614.1 | Paenibacillus barcinonensis |
| 135 | 2466219 | 2466419 | + | NZ_CP060414.1 | Neisseria musculi |
| 136 | 767338 | 767589 | - | NZ_CP045562.1 | Fructilactobacillus fructivorans |
| 137 | 1023228 | 1023449 | - | NZ_CP041364.1 | Schleiferilactobacillus harbinensis |
| 138 | 2431604 | 2431843 | - | NZ_CP024109.1 | Bacillus cytotoxicus |
| 139 | 2546785 | 2546985 | + | NZ_CP014912.1 | Secundilactobacillus paracollinoides |
| 140 | 1659676 | 1659918 | - | NZ_CP018776.1 | Staphylococcus condimenti |
| 141 | 1935876 | 1936079 | + | NZ_CP029971.1 | Lentilactobacillus kefiri |
| 142 | 1552794 | 1553033 | - | NZ_CP040586.1 | Furfurilactobacillus rossiae |
| 143 | 2006559 | 2006792 | + | NZ_LT906434.1 | Neisseria zoodegmatis |
| 144 | 1050998 | 1051237 | + | NZ_CP012047.1 | Tetragenococcus halophilus |
| 145 | 2778629 | 2778853 | - | NZ_AP017312.1 | Aneurinibacillus soli |
| 146 | 2074438 | 2074677 | - | NZ_CP019728.1 | Jeotgalibaca dankookensis |
| 147 | 1155608 | 1155844 | - | NZ_AP019750.1 | Lactobacillus delbrueckii subsp. delbrueckii |
| 148 | 1673582 | 1673809 | - | NZ_LR134483.1 | Listeria grayi |
| 149 | 2172651 | 2172872 | + | NZ_CP059567.1 | Neisseria shayeganii |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_002570.2
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF03672.15 | 0.76 | 112 | 2755 | same-strand | Uncharacterised protein family (UPF0154) |
| 2 | PF00456.23 | 0.81 | 120 | 120 | same-strand | Transketolase, thiamine diphosphate binding domain |
| 3 | PF02779.26 | 0.81 | 120 | 120 | same-strand | Transketolase, pyrimidine binding domain |
| 4 | PF02780.22 | 0.78 | 116 | 120 | same-strand | Transketolase, C-terminal domain |
| 5 | PF00717.25 | 0.91 | 134 | 1056 | opposite-strand | Peptidase S24-like |
| 6 | PF01726.18 | 0.91 | 135 | 1046.0 | opposite-strand | LexA DNA binding domain |
++ More..